STAT1

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
STAT1
Stat1 stucture.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи STAT1, CANDF7, IMD31A, IMD31B, IMD31C, ISGF-3, STAT91, signal transducer and activator of transcription 1
Зовнішні ІД OMIM: 600555 MGI: 103063 HomoloGene: 21428 GeneCards: STAT1
Шаблон експресії
PBB GE STAT1 200887 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_007315
NM_139266
NM_001205313
NM_001205314
NM_009283
NM_001357627
RefSeq (білок)
NP_009330
NP_644671
н/д
Локус (UCSC) Хр. 2: 190.96 – 191.02 Mb Хр. 1: 52.12 – 52.16 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

STAT1 (англ. Signal transducer and activator of transcription 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 2-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 750 амінокислот, а молекулярна маса — 87 335[4].

Послідовність амінокислот
1020304050
MSQWYELQQLDSKFLEQVHQLYDDSFPMEIRQYLAQWLEKQDWEHAANDV
SFATIRFHDLLSQLDDQYSRFSLENNFLLQHNIRKSKRNLQDNFQEDPIQ
MSMIIYSCLKEERKILENAQRFNQAQSGNIQSTVMLDKQKELDSKVRNVK
DKVMCIEHEIKSLEDLQDEYDFKCKTLQNREHETNGVAKSDQKQEQLLLK
KMYLMLDNKRKEVVHKIIELLNVTELTQNALINDELVEWKRRQQSACIGG
PPNACLDQLQNWFTIVAESLQQVRQQLKKLEELEQKYTYEHDPITKNKQV
LWDRTFSLFQQLIQSSFVVERQPCMPTHPQRPLVLKTGVQFTVKLRLLVK
LQELNYNLKVKVLFDKDVNERNTVKGFRKFNILGTHTKVMNMEESTNGSL
AAEFRHLQLKEQKNAGTRTNEGPLIVTEELHSLSFETQLCQPGLVIDLET
TSLPVVVISNVSQLPSGWASILWYNMLVAEPRNLSFFLTPPCARWAQLSE
VLSWQFSSVTKRGLNVDQLNMLGEKLLGPNASPDGLIPWTRFCKENINDK
NFPFWLWIESILELIKKHLLPLWNDGCIMGFISKERERALLKDQQPGTFL
LRFSESSREGAITFTWVERSQNGGEPDFHAVEPYTKKELSAVTFPDIIRN
YKVMAAENIPENPLKYLYPNIDKDHAFGKYYSRPKEAPEPMELDGPKGTG
YIKTELISVSEVHPSRLQTTDNLLPMSPEEFDEVSRIVGSVEFDSMMNTV

Кодований геном білок за функціями належить до активаторів, фосфопротеїнів. Задіяний у таких біологічних процесах як взаємодія хазяїн-вірус, транскрипція, регуляція транскрипції, антивірусний захист, поліморфізм, ацетиляція, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у цитоплазмі, ядрі.

Література[ред. | ред. код]

  • Schindler C., Fu X.-Y., Improta T., Aebersold R., Darnell J.E. Jr. (1992). Proteins of transcription factor ISGF-3: one gene encodes the 91- and 84-kDa ISGF-3 proteins that are activated by interferon alpha.. Proc. Natl. Acad. Sci. U.S.A. 89: 7836 — 7839.  PubMed DOI:10.1073/pnas.89.16.7836
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Yan R., Qureshi S., Zhong Z., Wen Z., Darnell J.E. Jr. (1995). The genomic structure of the STAT genes: multiple exons in coincident sites in Stat1 and Stat2.. Nucleic Acids Res. 23: 459 — 463.  PubMed DOI:10.1093/nar/23.3.459
  • Fu X.Y. (1992). A transcription factor with SH2 and SH3 domains is directly activated by an interferon alpha-induced cytoplasmic protein tyrosine kinase(s).. Cell 70: 323 — 335.  PubMed DOI:10.1016/0092-8674(92)90106-M
  • Wen Z., Zhong Z., Darnell J.E. Jr. (1995). Maximal activation of transcription by Stat1 and Stat3 requires both tyrosine and serine phosphorylation.. Cell 82: 241 — 250.  PubMed DOI:10.1016/0092-8674(95)90311-9
  • Li X., Leung S., Kerr I.M., Stark G.R. (1997). Functional subdomains of STAT2 required for preassociation with the alpha interferon receptor and for signaling.. Mol. Cell. Biol. 17: 2048 — 2056.  PubMed DOI:10.1128/MCB.17.4.2048

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:11362 (англ.). Процитовано 28 серпня 2017. 
  4. UniProt, P42224 (англ.). Процитовано 28 серпня 2017. 

Див. також[ред. | ред. код]