TEAD3

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
TEAD3
Protein TEAD3 PDB 2hzd.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи TEAD3, DTEF-1, ETFR-1, TEAD-3, TEAD5, TEF-5, TEF5, TEA domain transcription factor 3
Зовнішні ІД OMIM: 603170 MGI: 109241 HomoloGene: 81821 GeneCards: TEAD3
Шаблон експресії
PBB GE TEAD3 209454 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_003214
NM_001098226
NM_001204156
NM_011566
RefSeq (білок)
NP_003205
NP_001091696
NP_001191085
NP_035696
Локус (UCSC) Хр. 6: 35.47 – 35.5 Mb Хр. 17: 28.33 – 28.35 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

TEAD3 (англ. TEA domain transcription factor 3) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 6-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 435 амінокислот, а молекулярна маса — 48 676[4].

Послідовність амінокислот
1020304050
MASNSWNASSSPGEAREDGPEGLDKGLDNDAEGVWSPDIEQSFQEALAIY
PPCGRRKIILSDEGKMYGRNELIARYIKLRTGKTRTRKQVSSHIQVLARK
KVREYQVGIKAMNLDQVSKDKALQSMASMSSAQIVSASVLQNKFSPPSPL
PQAVFSTSSRFWSSPPLLGQQPGPSQDIKPFAQPAYPIQPPLPPTLSSYE
PLAPLPSAAASVPVWQDRTIASSRLRLLEYSAFMEVQRDPDTYSKHLFVH
IGQTNPAFSDPPLEAVDVRQIYDKFPEKKGGLKELYEKGPPNAFFLVKFW
ADLNSTIQEGPGAFYGVSSQYSSADSMTISVSTKVCSFGKQVVEKVETEY
ARLENGRFVYRIHRSPMCEYMINFIHKLKHLPEKYMMNSVLENFTILQVV
TSRDSQETLLVIAFVFEVSTSEHGAQHHVYKLVKD

Кодований геном білок за функціями належить до активаторів, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, ацетилювання. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Jacquemin P., Martial J.A., Davidson I. (1997). Human TEF-5 is preferentially expressed in placenta and binds to multiple functional elements of the human chorionic somatomammotropin-B gene enhancer.. J. Biol. Chem. 272: 12928 — 12937.  PubMed DOI:10.1074/jbc.272.20.12928
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:11716 (англ.). Процитовано 6 вересня 2017. 
  4. UniProt, Q99594 (англ.). Процитовано 6 вересня 2017. 

Див. також[ред. | ред. код]