BCL7A

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
BCL7A
Ідентифікатори
Символи BCL7A, BCL7, B-cell CLL/lymphoma 7A, BCL tumor suppressor 7A, BAF complex component, BAF chromatin remodeling complex subunit BCL7A
Зовнішні ІД OMIM: 601406 MGI: 1924295 HomoloGene: 10869 GeneCards: BCL7A
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_020993
NM_001024808
NM_029850
RefSeq (білок)
NP_001019979
NP_066273
NP_084126
Локус (UCSC) Хр. 12: 122.02 – 122.06 Mb Хр. 5: 123.34 – 123.37 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

BCL7A (англ. BCL tumor suppressor 7A) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 12-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 210 амінокислот, а молекулярна маса — 22 810[4].

Послідовність амінокислот
1020304050
MSGRSVRAETRSRAKDDIKRVMAAIEKVRKWEKKWVTVGDTSLRIYKWVP
VTEPKVDDKNKNKKKGKDEKCGSEVTTPENSSSPGMMDMHDDNSNQSSIA
DASPIKQENSSNSSPAPEPNSAVPSDGTEAKVDEAQADGKEHPGAEDASD
EQNSQSSMEHSMNSSEKVDRQPSGDSGLAAETSAISQDLEGVPPSKKMKL
EASQQNSEEM

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у такому біологічному процесі, як альтернативний сплайсинг.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:1004 (англ.). Процитовано 11 вересня 2017. 
  4. UniProt, Q4VC05 (англ.). Процитовано 11 вересня 2017. 

Див. також[ред. | ред. код]