DLX5

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
Distal-less homeobox 5
Ідентифікатори
Символи split hand/foot malformation type 1 with sensorineural hearing losshomeobox protein DLX-5DLX5distal-less homeo box 5
Зовнішні ІД GeneCards: [1]
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
н/д
н/д
RefSeq (білок)
н/д
н/д
Локус (UCSC) н/д н/д
PubMed search н/д н/д
Вікідані
Див./Ред. для людей

DLX5 (англ. Distal-less homeobox 5) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 7-ї хромосоми.[1] Довжина поліпептидного ланцюга білка становить 289 амінокислот, а молекулярна маса — 31 540[2].

Послідовність амінокислот
1020304050
MTGVFDRRVPSIRSGDFQAPFQTSAAMHHPSQESPTLPESSATDSDYYSP
TGGAPHGYCSPTSASYGKALNPYQYQYHGVNGSAGSYPAKAYADYSYASS
YHQYGGAYNRVPSATNQPEKEVTEPEVRMVNGKPKKVRKPRTIYSSFQLA
ALQRRFQKTQYLALPERAELAASLGLTQTQVKIWFQNKRSKIKKIMKNGE
MPPEHSPSSSDPMACNSPQSPAVWEPQGSSRSLSHHPHAHPPTSNQSPAS
SYLENSASWYTSAASSINSHLPPPGSLQHPLALASGTLY

Кодований геном білок за функціями належить до активаторів, білків розвитку, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, остеогенез, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Xu J., Testa J.R. (2009). DLX5 (distal-less homeobox 5) promotes tumor cell proliferation by transcriptionally regulating MYC.. J. Biol. Chem. 284: 20593 — 20601.  PubMed DOI:10.1074/jbc.M109.021477
  • Shamseldin H.E., Faden M.A., Alashram W., Alkuraya F.S. (2012). Identification of a novel DLX5 mutation in a family with autosomal recessive split hand and foot malformation.. J. Med. Genet. 49: 16 — 20.  PubMed DOI:10.1136/jmedgenet-2011-100556

Примітки[ред. | ред. код]

  1. HUGO Gene Nomenclature Commitee, HGNC:2918 (англ.). Процитовано 7 вересня 2017. 
  2. UniProt, P56178 (англ.). Процитовано 7 вересня 2017. 

Див. також[ред. | ред. код]