MAFG

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
MAFG
Crystal structure of the MafA homodimer.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи MAFG, hMAF, MAF bZIP transcription factor G
Зовнішні ІД OMIM: 602020 MGI: 96911 HomoloGene: 81816 GeneCards: MAFG
Шаблон експресії
PBB GE MAFG gnf1h00895 at fs.png

PBB GE MAFG 204970 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_002359
NM_032711
NM_010756
RefSeq (білок)
NP_002350
NP_116100
NP_034886
Локус (UCSC) Хр. 17: 81.92 – 81.93 Mb Хр. 11: 120.63 – 120.63 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

MAFG (англ. MAF bZIP transcription factor G) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 17-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 162 амінокислот, а молекулярна маса — 17 850[4].

Послідовність амінокислот
1020304050
MTTPNKGNKALKVKREPGENGTSLTDEELVTMSVRELNQHLRGLSKEEIV
QLKQRRRTLKNRGYAASCRVKRVTQKEELEKQKAELQQEVEKLASENASM
KLELDALRSKYEALQTFARTVARSPVAPARGPLAAGLGPLVPGKVAATSV
ITIVKSKTDARS

Кодований геном білок за функціями належить до репресорів, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, ацетилювання. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Blank V., Knoll J.H.M., Andrews N.C. (1997). Molecular characterization and localization of the human MAFG gene.. Genomics 44: 147 — 149.  PubMed DOI:10.1006/geno.1997.4847
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Hung H.-L., Kim A.Y., Hong W., Rakowski C., Blobel G.A. (2001). Stimulation of NF-E2 DNA binding by CREB-binding protein (CBP)-mediated acetylation.. J. Biol. Chem. 276: 10715 — 10721.  PubMed DOI:10.1074/jbc.M007846200
  • Impens F., Radoshevich L., Cossart P., Ribet D. (2014). Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.. Proc. Natl. Acad. Sci. U.S.A. 111: 12432 — 12437.  PubMed DOI:10.1073/pnas.1413825111
  • Hendriks I.A., Treffers L.W., Verlaan-de Vries M., Olsen J.V., Vertegaal A.C. (2015). SUMO-2 orchestrates chromatin modifiers in response to DNA damage.. Cell Rep. 10: 1778 — 1791.  PubMed DOI:10.1016/j.celrep.2015.02.033
  • Blank V., Kim M.J., Andrews N.C. (1997). Human MafG is a functional partner for p45 NF-E2 in activating globin gene expression.. Blood 89: 3925 — 3935.  PubMed

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:6781 (англ.). Процитовано 12 вересня 2017. 
  4. UniProt, O15525 (англ.). Процитовано 12 вересня 2017. 

Див. також[ред. | ред. код]