LYL1

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
LYL1
Ідентифікатори
Символи LYL1, bHLHa18, lymphoblastic leukemia associated hematopoiesis regulator 1, basic helix-loop-helix family member, LYL1 basic helix-loop-helix family member
Зовнішні ІД OMIM: 151440 MGI: 96891 HomoloGene: 4078 GeneCards: LYL1
Шаблон експресії
PBB GE LYL1 210044 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_005583
NM_008535
RefSeq (білок)
NP_005574
NP_032561
Локус (UCSC) Хр. 19: 13.1 – 13.1 Mb Хр. 8: 84.7 – 84.7 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

LYL1 (англ. LYL1, basic helix-loop-helix family member) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 19-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 280 амінокислот, а молекулярна маса — 29 938[4].

Послідовність амінокислот
1020304050
MCPPQAQAEVGPTMTEKAEMVCAPSPAPAPPPKPASPGPPQVEEVGHRGG
SSPPRLPPGVPVISLGHSRPPGVAMPTTELGTLRPPLLQLSTLGTAPPTL
ALHYHPHPFLNSVYIGPAGPFSIFPSSRLKRRPSHCELDLAEGHQPQKVA
RRVFTNSRERWRQQNVNGAFAELRKLLPTHPPDRKLSKNEVLRLAMKYIG
FLVRLLRDQAAALAAGPTPPGPRKRPVHRVPDDGARRGSGRRAEAAARSQ
PAPPADPDGSPGGAARPIKMEQTALSPEVR

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Mellentin J.D., Smith S.D., Cleary M.L. (1989). lyl-1, a novel gene altered by chromosomal translocation in T cell leukemia, codes for a protein with a helix-loop-helix DNA binding motif.. Cell 58: 77 — 83.  PubMed DOI:10.1016/0092-8674(89)90404-2
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:6734 (англ.). Процитовано 12 вересня 2017. 
  4. UniProt, P12980 (англ.). Процитовано 12 вересня 2017. 

Див. також[ред. | ред. код]