TEAD4

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
TEAD4
Protein TEAD4 PDB 2hzd.png
Ідентифікатори
Символи TEAD4, EFTR-2, RTEF1, TCF13L1, TEF-3, TEF3, TEFR-1, hRTEF-1B, TEA domain transcription factor 4
Зовнішні ІД OMIM: 601714 MGI: 106907 HomoloGene: 74463 GeneCards: TEAD4
Шаблон експресії
PBB GE TEAD4 204281 at fs.png

PBB GE TEAD4 41037 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_201443
NM_003213
NM_201441
NM_001080979
NM_011567
RefSeq (білок)
NP_003204
NP_958849
NP_958851
NP_001074448
NP_035697
Локус (UCSC) Хр. 12: 2.96 – 3.04 Mb Хр. 6: 128.22 – 128.3 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

TEAD4 (англ. TEA domain transcription factor 4) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 12-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 434 амінокислот, а молекулярна маса — 48 329[4].

Послідовність амінокислот
1020304050
MEGTAGTITSNEWSSPTSPEGSTASGGSQALDKPIDNDAEGVWSPDIEQS
FQEALAIYPPCGRRKIILSDEGKMYGRNELIARYIKLRTGKTRTRKQVSS
HIQVLARRKAREIQAKLKDQAAKDKALQSMAAMSSAQIISATAFHSSMAL
ARGPGRPAVSGFWQGALPGQAGTSHDVKPFSQQTYAVQPPLPLPGFESPA
GPAPSPSAPPAPPWQGRSVASSKLWMLEFSAFLEQQQDPDTYNKHLFVHI
GQSSPSYSDPYLEAVDIRQIYDKFPEKKGGLKDLFERGPSNAFFLVKFWA
DLNTNIEDEGSSFYGVSSQYESPENMIITCSTKVCSFGKQVVEKVETEYA
RYENGHYSYRIHRSPLCEYMINFIHKLKHLPEKYMMNSVLENFTILQVVT
NRDTQETLLCIAYVFEVSASEHGAQHHIYRLVKE

Кодований геном білок за функцією належить до активаторів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Jacquemin P., Hwang J.-J., Martial J.A., Dolle P., Davidson I. (1996). A novel family of developmentally regulated mammalian transcription factors containing the TEA/ATTS DNA binding domain.. J. Biol. Chem. 271: 21775 — 21785.  PubMed DOI:10.1074/jbc.271.36.21775

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:11717 (англ.). Процитовано 11 вересня 2017. 
  4. UniProt, Q15561 (англ.). Процитовано 11 вересня 2017. 

Див. також[ред. | ред. код]