CUX1

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
CUX1
Ідентифікатори
Символи CUX1, CASP, CDP, CDP/Cut, CDP1, COY1, CUTL1, CUX, Clox, Cux/CDP, GOLIM6, Nbla10317, p100, p110, p200, p75, cut like homeobox 1, GDDI
Зовнішні ІД OMIM: 116896 HomoloGene: 22551 GeneCards: CUX1
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
RefSeq (білок)
Локус (UCSC) Хр. 7: 101.82 – 102.28 Mb н/д
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

CUX1 (англ. Homeobox protein cut-like 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 7-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 1 505 амінокислот, а молекулярна маса — 164 187[4].

Послідовність амінокислот
1020304050
MLCVAGARLKRELDATATVLANRQDESEQSRKRLIEQSREFKKNTPEDLR
KQVAPLLKSFQGEIDALSKRSKEAEAAFLNVYKRLIDVPDPVPALDLGQQ
LQLKVQRLHDIETENQKLRETLEEYNKEFAEVKNQEVTIKALKEKIREYE
QTLKNQAETIALEKEQKLQNDFAEKERKLQETQMSTTSKLEEAEHKVQSL
QTALEKTRTELFDLKTKYDEETTAKADEIEMIMTDLERANQRAEVAQREA
ETLREQLSSANHSLQLASQIQKAPDVEQAIEVLTRSSLEVELAAKEREIA
QLVEDVQRLQASLTKLRENSASQISQLEQQLSAKNSTLKQLEEKLKGQAD
YEEVKKELNILKSMEFAPSEGAGTQDAAKPLEVLLLEKNRSLQSENAALR
ISNSDLSGSARRKGKDQPESRRPGSLPAPPPSQLPRNPGEQASNTNGTHQ
FSPAGLSQDFFSSSLASPSLPLASTGKFALNSLLQRQLMQSFYSKAMQEA
GSTSMIFSTGPYSTNSISSQSPLQQSPDVNGMAPSPSQSESAGSVSEGEE
MDTAEIARQVKEQLIKHNIGQRIFGHYVLGLSQGSVSEILARPKPWNKLT
VRGKEPFHKMKQFLSDEQNILALRSIQGRQRENPGQSLNRLFQEVPKRRN
GSEGNITTRIRASETGSDEAIKSILEQAKRELQVQKTAEPAQPSSASGSG
NSDDAIRSILQQARREMEAQQAALDPALKQAPLSQSDITILTPKLLSTSP
MPTVSSYPPLAISLKKPSAAPEAGASALPNPPALKKEAQDAPGLDPQGAA
DCAQGVLRQVKNEVGRSGAWKDHWWSAVQPERRNAASSEEAKAEETGGGK
EKGSGGSGGGSQPRAERSQLQGPSSSEYWKEWPSAESPYSQSSELSLTGA
SRSETPQNSPLPSSPIVPMSKPTKPSVPPLTPEQYEVYMYQEVDTIELTR
QVKEKLAKNGICQRIFGEKVLGLSQGSVSDMLSRPKPWSKLTQKGREPFI
RMQLWLNGELGQGVLPVQGQQQGPVLHSVTSLQDPLQQGCVSSESTPKTS
ASCSPAPESPMSSSESVKSLTELVQQPCPPIEASKDSKPPEPSDPPASDS
QPTTPLPLSGHSALSIQELVAMSPELDTYGITKRVKEVLTDNNLGQRLFG
ETILGLTQGSVSDLLARPKPWHKLSLKGREPFVRMQLWLNDPNNVEKLMD
MKRMEKKAYMKRRHSSVSDSQPCEPPSVGTEYSQGASPQPQHQLKKPRVV
LAPEEKEALKRAYQQKPYPSPKTIEDLATQLNLKTSTVINWFHNYRSRIR
RELFIEEIQAGSQGQAGASDSPSARSGRAAPSSEGDSCDGVEATEGPGSA
DTEEPKSQGEAEREEVPRPAEQTEPPPSGTPGPDDARDDDHEGGPVEGPG
PLPSPASATATAAPAAPEDAATSAAAAPGEGPAAPSSAPPPSNSSSSSAP
RRPSSLQSLFGLPEAAGARDSRDNPLRKKKAANLNSIIHRLEKAASREEP
IEWEF

Кодований геном білок за функціями належить до репресорів, білків розвитку, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Neufeld E.J., Skalnik D.G., Lievens P.M.-J., Orkin S.H. (1992). Human CCAAT displacement protein is homologous to the Drosophila homeoprotein, cut.. Nat. Genet. 1: 50 — 55.  PubMed DOI:10.1038/ng0492-50
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Hendriks I.A., Treffers L.W., Verlaan-de Vries M., Olsen J.V., Vertegaal A.C. (2015). SUMO-2 orchestrates chromatin modifiers in response to DNA damage.. Cell Rep. 10: 1778 — 1791.  PubMed DOI:10.1016/j.celrep.2015.02.033

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:2557 (англ.). Процитовано 7 вересня 2017. 
  4. UniProt, P39880 (англ.). Процитовано 7 вересня 2017. 

Див. також[ред. | ред. код]