RXRB

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
RXRB
Protein RXRB PDB 1by4.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи RXRB, DAUDI6, H-2RIIBP, NR2B2, RCoR-1, Retinoid X receptor beta
Зовнішні ІД OMIM: 180246 MGI: 98215 HomoloGene: 7923 GeneCards: RXRB
Реагує на сполуку
bexarotene[1]
Шаблон експресії
PBB GE RXRB 209148 at fs.png

PBB GE RXRB 215099 s at fs.png

PBB GE RXRB 215098 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001270401
NM_001291989
NM_021976
NM_001205214
NM_001205215
NM_001205216
NM_011306
RefSeq (білок)
NP_001257330
NP_001278918
NP_068811
NP_068811.1
NP_001192143
NP_001192144
NP_001192145
NP_035436
Локус (UCSC) Хр. 6: 33.19 – 33.2 Mb Хр. 17: 34.03 – 34.04 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

RXRB (англ. Retinoid X receptor beta) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 6-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 533 амінокислот, а молекулярна маса — 56 922[5].

Послідовність амінокислот
1020304050
MSWAARPPFLPQRHAAGQCGPVGVRKEMHCGVASRWRRRRPWLDPAAAAA
AAVAGGEQQTPEPEPGEAGRDGMGDSGRDSRSPDSSSPNPLPQGVPPPSP
PGPPLPPSTAPSLGGSGAPPPPPMPPPPLGSPFPVISSSMGSPGLPPPAP
PGFSGPVSSPQINSTVSLPGGGSGPPEDVKPPVLGVRGLHCPPPPGGPGA
GKRLCAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLTYSCRDNKDCTVD
KRQRNRCQYCRYQKCLATGMKREAVQEERQRGKDKDGDGEGAGGAPEEMP
VDRILEAELAVEQKSDQGVEGPGGTGGSGSSPNDPVTNICQAADKQLFTL
VEWAKRIPHFSSLPLDDQVILLRAGWNELLIASFSHRSIDVRDGILLATG
LHVHRNSAHSAGVGAIFDRVLTELVSKMRDMRMDKTELGCLRAIILFNPD
AKGLSNPSEVEVLREKVYASLETYCKQKYPEQQGRFAKLLLRLPALRSIG
LKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQLA

Кодований геном білок за функцією належить до рецепторів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном цинку, ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Fleischhauer K., McBride O.W., DiSanto J.P., Ozato K., Yang S.Y. (1993). Cloning and chromosome mapping of human retinoid X receptor beta: selective amino acid sequence conservation of a nuclear hormone receptor in mammals.. Hum. Genet. 90: 505 — 510.  PubMed DOI:10.1007/BF00217449

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]