NR4A3

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
NR4A3
Protein NR4A3 PDB 1cit.png
Ідентифікатори
Символи NR4A3, CHN, CSMF, MINOR, NOR1, TEC, nuclear receptor subfamily 4 group A member 3
Зовнішні ІД OMIM: 600542 MGI: 1352457 HomoloGene: 5074 GeneCards: NR4A3
Шаблон експресії
PBB GE NR4A3 207978 s at fs.png

PBB GE NR4A3 209959 at fs.png

PBB GE NR4A3 216979 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_006981
NM_173198
NM_173199
NM_173200
NM_015743
NM_001307989
RefSeq (білок)
NP_008912
NP_775291
NP_775292
NP_001294918
NP_056558
Локус (UCSC) Хр. 9: 99.82 – 99.87 Mb Хр. 4: 48.05 – 48.09 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

NR4A3 (англ. Nuclear receptor subfamily 4 group A member 3) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 9-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 626 амінокислот, а молекулярна маса — 68 230[4].

Послідовність амінокислот
1020304050
MPCVQAQYSPSPPGSSYAAQTYSSEYTTEIMNPDYTKLTMDLGSTEITAT
ATTSLPSISTFVEGYSSNYELKPSCVYQMQRPLIKVEEGRAPSYHHHHHH
HHHHHHHHQQQHQQPSIPPASSPEDEVLPSTSMYFKQSPPSTPTTPAFPP
QAGALWDEALPSAPGCIAPGPLLDPPMKAVPTVAGARFPLFHFKPSPPHP
PAPSPAGGHHLGYDPTAAAALSLPLGAAAAAGSQAAALESHPYGLPLAKR
AAPLAFPPLGLTPSPTASSLLGESPSLPSPPSRSSSSGEGTCAVCGDNAA
CQHYGVRTCEGCKGFFKRTVQKNAKYVCLANKNCPVDKRRRNRCQYCRFQ
KCLSVGMVKEVVRTDSLKGRRGRLPSKPKSPLQQEPSQPSPPSPPICMMN
ALVRALTDSTPRDLDYSRYCPTDQAAAGTDAEHVQQFYNLLTASIDVSRS
WAEKIPGFTDLPKEDQTLLIESAFLELFVLRLSIRSNTAEDKFVFCNGLV
LHRLQCLRGFGEWLDSIKDFSLNLQSLNLDIQALACLSALSMITERHGLK
EPKRVEELCNKITSSLKDHQSKGQALEPTESKVLGALVELRKICTLGLQR
IFYLKLEDLVSPPSIIDKLFLDTLPF

Кодований геном білок за функцією належить до рецепторів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном цинку, ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Hedvat C.V., Irving S.G. (1995). The isolation and characterization of MINOR, a novel mitogen-inducible nuclear orphan receptor.. Mol. Endocrinol. 9: 1692 — 1700.  PubMed DOI:10.1210/mend.9.12.8614405
  • Liu Q., Zhu X., Xu L., Fu Y., Garvey W.T. (2013). 6-Mercaptopurine augments glucose transport activity in skeletal muscle cells in part via a mechanism dependent upon orphan nuclear receptor NR4A3.. Am. J. Physiol. 305: E1081 — E1092.  PubMed DOI:10.1152/ajpendo.00169.2013

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:7982 (англ.). Процитовано 8 вересня 2017. 
  4. UniProt, Q92570 (англ.). Процитовано 8 вересня 2017. 

Див. також[ред. | ред. код]