FOXD4

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
FOXD4
Ідентифікатори
Символи FOXD4, FKHL9, FOXD4A, FREAC-5, FREAC5, forkhead box D4
Зовнішні ІД OMIM: 601092 MGI: 1347467 HomoloGene: 83248 GeneCards: FOXD4
Шаблон експресії
PBB GE FOXD4 217032 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_207305
NM_008022
RefSeq (білок)
NP_997188
NP_032048
Локус (UCSC) Хр. 9: 0.12 – 0.12 Mb Хр. 19: 24.9 – 24.9 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

FOXD4 (англ. Forkhead box D4) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 9-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 439 амінокислот, а молекулярна маса — 47 309[4].

Послідовність амінокислот
1020304050
MNLPRAERLRSTPQRSLRDSDGEDGKIDVLGEEEDEDEEEAASQQFLEQS
LQPGLQVARWGGVALPREHIEGGGGPSDPSEFGTEFRAPPRSAAASEDAR
QPAKPPSSYIALITMAILQSPHKRLTLSGICAFISDRFPYYRRKFPAWQN
SIRHNLSLNDCFVKIPREPGRPGKGNYWSLDPASQDMFDNGSFLRRRKRF
QRHQPTPGAHLPHPFPLPAAHAALHNPRPGPLLGAPAPPQPVPGAYPNTG
PGRRPYALLHPHPPRYLLLSAPAYAGAPKKAEGADLATPAPFPCCSPHLV
LSLGRRARVWRRHREADASLSALRVSCKGSGERVQGLRRVCPRPRGATAP
CSSDRQACRTILQQQQRHQEEDCANGCAPTKGAVLGGHLSAASALLRYQA
VAEGSGLTSLAAPLGGEGTSPVFLVSPTPSSLAESAGPS

Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Freyaldenhoven B.S., Fried C., Wielckens K. (2002). FOXD4a and FOXD4b, two new winged helix transcription factors, are expressed in human leukemia cell lines.. Gene 294: 131 — 140.  PubMed DOI:10.1016/S0378-1119(02)00702-3
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Fan Y., Newman T., Linardopoulou E., Trask B.J. (2002). Gene content and function of the ancestral chromosome fusion site in human chromosome 2q13-2q14.1 and paralogous regions.. Genome Res. 12: 1663 — 1672.  PubMed DOI:10.1101/gr.338402
  • Pierrou S., Hellqvist M., Samuelsson L., Enerbaeck S., Carlsson P. (1994). Cloning and characterization of seven human forkhead proteins: binding site specificity and DNA bending.. EMBO J. 13: 5002 — 5012.  PubMed

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:3805 (англ.). Процитовано 7 вересня 2017. 
  4. UniProt, Q12950 (англ.). Процитовано 7 вересня 2017. 

Див. також[ред. | ред. код]