BACH2

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
BACH2
3ohu.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи BACH2, BTBD25, BTB domain and CNC homolog 2, IMD60
Зовнішні ІД OMIM: 605394 MGI: 894679 HomoloGene: 7240 GeneCards: BACH2
Пов'язані генетичні захворювання
Цукровий діабет тип 1, Ожиріння, Вітиліго, Розсіяний склероз, Хвороба Крона, Целіакія[1]
Шаблон експресії
PBB GE BACH2 221234 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001170794
NM_021813
NM_001109661
NM_007521
RefSeq (білок)
NP_001164265
NP_068585
NP_001103131
Локус (UCSC) Хр. 6: 89.93 – 90.3 Mb Хр. 4: 32.24 – 32.59 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

BACH2 (англ. BTB domain and CNC homolog 2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 6-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 841 амінокислот, а молекулярна маса — 92 537[5].

Послідовність амінокислот
1020304050
MSVDEKPDSPMYVYESTVHCTNILLGLNDQRKKDILCDVTLIVERKEFRA
HRAVLAACSEYFWQALVGQTKNDLVVSLPEEVTARGFGPLLQFAYTAKLL
LSRENIREVIRCAEFLRMHNLEDSCFSFLQTQLLNSEDGLFVCRKDAACQ
RPHEDCENSAGEEEDEEEETMDSETAKMACPRDQMLPEPISFEAAAIPVA
EKEEALLPEPDVPTDTKESSEKDALTQYPRYKKYQLACTKNVYNASSHST
SGFASTFREDNSSNSLKPGLARGQIKSEPPSEENEEESITLCLSGDEPDA
KDRAGDVEMDRKQPSPAPTPTAPAGAACLERSRSVASPSCLRSLFSITKS
VELSGLPSTSQQHFARSPACPFDKGITQGDLKTDYTPFTGNYGQPHVGQK
EVSNFTMGSPLRGPGLEALCKQEGELDRRSVIFSSSACDQVSTSVHSYSG
VSSLDKDLSEPVPKGLWVGAGQSLPSSQAYSHGGLMADHLPGRMRPNTSC
PVPIKVCPRSPPLETRTRTSSSCSSYSYAEDGSGGSPCSLPLCEFSSSPC
SQGARFLATEHQEPGLMGDGMYNQVRPQIKCEQSYGTNSSDESGSFSEAD
SESCPVQDRGQEVKLPFPVDQITDLPRNDFQMMIKMHKLTSEQLEFIHDV
RRRSKNRIAAQRCRKRKLDCIQNLECEIRKLVCEKEKLLSERNQLKACMG
ELLDNFSCLSQEVCRDIQSPEQIQALHRYCPVLRPMDLPTASSINPAPLG
AEQNIAASQCAVGENVPCCLEPGAAPPGPPWAPSNTSENCTSGRRLEGTD
PGTFSERGPPLEPRSQTVTVDFCQEMTDKCTTDEQPRKDYT

Кодований геном білок за функціями належить до репресорів, активаторів, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції. Білок має сайт для зв'язування з ДНК. Локалізований у цитоплазмі, ядрі.

Література[ред. | ред. код]

  • Rosbrook G.O., Stead M.A., Carr S.B., Wright S.C. (2012). The structure of the Bach2 POZ-domain dimer reveals an intersubunit disulfide bond.. Acta Crystallogr. D 68: 26 — 34.  PubMed DOI:10.1107/S0907444911048335

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]