SMAD1

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
SMAD1
Protein SMAD1 PDB 1khu.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи SMAD1, BSP-1, BSP1, JV4-1, JV41, MADH1, MADR1, SMAD family member 1
Зовнішні ІД OMIM: 601595 MGI: 109452 HomoloGene: 21196 GeneCards: SMAD1
Шаблон експресії
PBB GE SMAD1 210993 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001003688
NM_005900
NM_008539
RefSeq (білок)
NP_032565
Локус (UCSC) н/д Хр. 8: 79.34 – 79.4 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

SMAD1 (англ. SMAD family member 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 4-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 465 амінокислот, а молекулярна маса — 52 260[4].

Послідовність амінокислот
1020304050
MNVTSLFSFTSPAVKRLLGWKQGDEEEKWAEKAVDALVKKLKKKKGAMEE
LEKALSCPGQPSNCVTIPRSLDGRLQVSHRKGLPHVIYCRVWRWPDLQSH
HELKPLECCEFPFGSKQKEVCINPYHYKRVESPVLPPVLVPRHSEYNPQH
SLLAQFRNLGQNEPHMPLNATFPDSFQQPNSHPFPHSPNSSYPNSPGSSS
STYPHSPTSSDPGSPFQMPADTPPPAYLPPEDPMTQDGSQPMDTNMMAPP
LPSEINRGDVQAVAYEEPKHWCSIVYYELNNRVGEAFHASSTSVLVDGFT
DPSNNKNRFCLGLLSNVNRNSTIENTRRHIGKGVHLYYVGGEVYAECLSD
SSIFVQSRNCNYHHGFHPTTVCKIPSGCSLKIFNNQEFAQLLAQSVNHGF
ETVYELTKMCTIRMSFVKGWGAEYHRQDVTSTPCWIEIHLHGPLQWLDKV
LTQMGSPHNPISSVS

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах як транскрипція, регуляція транскрипції, поліморфізм, ацетиляція, альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном цинку, ДНК. Локалізований у цитоплазмі, ядрі.

Література[ред. | ред. код]

  • Lechleider R.J., de Caestecker M.P., Dehejia A., Polymeropoulos M.H., Roberts A.B. (1996). Serine phosphorylation, chromosomal localization, and transforming growth factor-beta signal transduction by human bsp-1.. J. Biol. Chem. 271: 17617 — 17620.  PubMed DOI:10.1074/jbc.271.30.17617
  • Zhang Y., Feng X.-H., Wu R.-Y., Derynck R. (1996). Receptor-associated Mad homologues synergize as effectors of the TGF-beta response.. Nature 383: 168 — 172.  PubMed DOI:10.1038/383168a0
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Kretzschmar M., Liu F., Hata A., Doody J., Massague J. (1997). The TGF-beta family mediator Smad1 is phosphorylated directly and activated functionally by the BMP receptor kinase.. Genes Dev. 11: 984 — 995.  PubMed DOI:10.1101/gad.11.8.984
  • Massague J. (1998). TGF-beta signal transduction.. Annu. Rev. Biochem. 67: 753 — 791.  PubMed DOI:10.1146/annurev.biochem.67.1.753
  • Verschueren K., Huylebroeck D. (1999). Remarkable versatility of Smad proteins in the nucleus of transforming growth factor-beta activated cells.. Cytokine Growth Factor Rev. 10: 187 — 199.  PubMed DOI:10.1016/S1359-6101(99)00012-X

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:6767 (англ.). Процитовано 30 серпня 2017. 
  4. UniProt, Q15797 (англ.). Процитовано 30 серпня 2017. 

Див. також[ред. | ред. код]