PPARD

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
PPARD
Protein PPARD PDB 1gwx.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи PPARD, FAAR, NR1C2, NUC1, NUCI, NUCII, PPARB, peroxisome proliferator activated receptor delta
Зовнішні ІД OMIM: 600409 MGI: 101884 HomoloGene: 4544 GeneCards: PPARD
Пов'язані генетичні захворювання
Цукровий діабет 2-го типу, diabetic cataract[1]
Реагує на сполуку
GW0742X, gw-501516, Третиноїн[2]
Шаблон експресії
PBB GE PPARD 208044 s at fs.png

PBB GE PPARD 37152 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001171818
NM_001171819
NM_001171820
NM_006238
NM_177435
NM_011145
RefSeq (білок)
NP_001165289
NP_001165290
NP_001165291
NP_006229
NP_803184
NP_035275
Локус (UCSC) Хр. 6: 35.34 – 35.43 Mb Хр. 17: 28.23 – 28.3 Mb
PubMed search [3] [4]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

PPARD (англ. Peroxisome proliferator activated receptor delta) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 6-ї хромосоми.[5] Довжина поліпептидного ланцюга білка становить 441 амінокислот, а молекулярна маса — 49 903[6].

Послідовність амінокислот
1020304050
MEQPQEEAPEVREEEEKEEVAEAEGAPELNGGPQHALPSSSYTDLSRSSS
PPSLLDQLQMGCDGASCGSLNMECRVCGDKASGFHYGVHACEGCKGFFRR
TIRMKLEYEKCERSCKIQKKNRNKCQYCRFQKCLALGMSHNAIRFGRMPE
AEKRKLVAGLTANEGSQYNPQVADLKAFSKHIYNAYLKNFNMTKKKARSI
LTGKASHTAPFVIHDIETLWQAEKGLVWKQLVNGLPPYKEISVHVFYRCQ
CTTVETVRELTEFAKSIPSFSSLFLNDQVTLLKYGVHEAIFAMLASIVNK
DGLLVANGSGFVTREFLRSLRKPFSDIIEPKFEFAVKFNALELDDSDLAL
FIAAIILCGDRPGLMNVPRVEAIQDTILRALEFHLQANHPDAQYLFPKLL
QKMADLRQLVTEHAQMMQRIKKTETETSLHPLLQEIYKDMY

Кодований геном білок за функціями належить до рецепторів, активаторів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном цинку, ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Kobayashi T., Kodani Y., Nozawa A., Endo Y., Sawasaki T. (2008). DNA-binding profiling of human hormone nuclear receptors via fluorescence correlation spectroscopy in a cell-free system.. FEBS Lett. 582: 2737 — 2744.  PubMed DOI:10.1016/j.febslet.2008.07.003
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]