MYT1

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
MYT1
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи MYT1, C20orf36, MTF1, MYTI, NZF2, PLPB1, ZC2HC4A, ZC2H2C1, myelin transcription factor 1
Зовнішні ІД OMIM: 600379 MGI: 1100535 HomoloGene: 3332 GeneCards: MYT1
Шаблон експресії
PBB GE MYT1 210341 at fs.png

PBB GE MYT1 215822 x at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_004535
NM_001171615
NM_001171616
NM_001171680
NM_008665
RefSeq (білок)
NP_004526
NP_001165086
NP_001165087
NP_001165151
NP_032691
Локус (UCSC) Хр. 20: 64.1 – 64.24 Mb Хр. 2: 181.76 – 181.83 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

MYT1 (англ. Myelin transcription factor 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 20-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 1 121 амінокислот, а молекулярна маса — 122 329[4].

Послідовність амінокислот
1020304050
MSLENEDKRARTRSKALRGPPETTAADLSCPTPGCTGSGHVRGKYSRHRS
LQSCPLAKKRKLEGAEAEHLVSKRKSHPLKLALDEGYGVDSDGSEDTEVK
DASVSDESEGTLEGAEAETSGQDEIHRPETAEGRSPVKSHFGSNPIGSAT
ASSKGSYSSYQGIIATSLLNLGQIAEETLVEEDLGQAAKPGPGIVHLLQE
AAEGAASEEGEKGLFIQPEDAEEVVEVTTERSQDLCPQSLEDAASEESSK
QKGILSHEEEDEEEEEEEEEEEEDEEEEEEEEEEEEEEEEEEEEEEEEEE
EEEEEEAAPDVIFQEDTSHTSAQKAPELRGPESPSPKPEYSVIVEVRSDD
DKDEDTHSRKSTVTDESEMQDMMTRGNLGLLEQAIALKAEQVRTVCEPGC
PPAEQSQLGLGEPGKAAKPLDTVRKSYYSKDPSRAEKREIKCPTPGCDGT
GHVTGLYPHHRSLSGCPHKDRIPPEILAMHENVLKCPTPGCTGQGHVNSN
RNTHRSLSGCPIAAAEKLAKSHEKQQPQTGDPSKSSSNSDRILRPMCFVK
QLEVPPYGSYRPNVAPATPRANLAKELEKFSKVTFDYASFDAQVFGKRML
APKIQTSETSPKAFQCFDYSQDAEAAHMAATAILNLSTRCWEMPENLSTK
PQDLPSKSVDIEVDENGTLDLSMHKHRKRENAFPSSSSCSSSPGVKSPDA
SQRHSSTSAPSSSMTSPQSSQASRQDEWDRPLDYTKPSRLREEEPEESEP
AAHSFASSEADDQEVSEENFEERKYPGEVTLTNFKLKFLSKDIKKELLTC
PTPGCDGSGHITGNYASHRSLSGCPLADKSLRNLMAAHSADLKCPTPGCD
GSGHITGNYASHRSLSGCPRAKKSGVKVAPTKDDKEDPELMKCPVPGCVG
LGHISGKYASHRSASGCPLAARRQKEGSLNGSSFSWKSLKNEGPTCPTPG
CDGSGHANGSFLTHRSLSGCPRATFAGKKGKLSGDEVLSPKFKTSDVLEN
DEEIKQLNQEIRDLNESNSEMEAAMVQLQSQISSMEKNLKNIEEENKLIE
EQNEALFLELSGLSQALIQSLANIRLPHMEPICEQNFDAYVSTLTDMYSN
QDPENKDLLESIKQAVRGIQV

Кодований геном білок за функцією належить до білків розвитку. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, диференціація клітин, нейрогенез, альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном цинку, ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Kim J.G., Hudson L.D. (1992). Novel member of the zinc finger superfamily: a C2-HC finger that recognizes a glia-specific gene.. Mol. Cell. Biol. 12: 5632 — 5639.  PubMed DOI:10.1128/MCB.12.12.5632
  • Armstrong R.C., Kim J.G., Hudson L.D. (1995). Expression of myelin transcription factor I (MyTI), a 'zinc-finger' DNA-binding protein, in developing oligodendrocytes.. Glia 14: 303 — 321.  PubMed DOI:10.1002/glia.440140407
  • Nielsen J.A., Berndt J.A., Hudson L.D., Armstrong R.C. (2004). Myelin transcription factor 1 (Myt1) modulates the proliferation and differentiation of oligodendrocyte lineage cells.. Mol. Cell. Neurosci. 25: 111 — 123.  PubMed DOI:10.1016/j.mcn.2003.10.001

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:7622 (англ.). Процитовано 12 вересня 2017. 
  4. UniProt, Q01538 (англ.). Процитовано 12 вересня 2017. 

Див. також[ред. | ред. код]