LEF1

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
LEF1
Protein LEF1 PDB 2lef.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи LEF1, LEF-1, TCF10, TCF1ALPHA, TCF7L3, lymphoid enhancer binding factor 1
Зовнішні ІД MGI: 96770 HomoloGene: 7813 GeneCards: LEF1
Пов'язані генетичні захворювання
хронічний лімфолейкоз, системний червоний вовчак[1]
Шаблон експресії
PBB GE LEF1 210948 s at fs.png

PBB GE LEF1 221557 s at fs.png

PBB GE LEF1 221558 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001130713
NM_001130714
NM_001166119
NM_016269
NM_001276402
NM_001276403
NM_010703
RefSeq (білок)
NP_001124185
NP_001124186
NP_001159591
NP_057353
NP_057353.1
NP_001263331
NP_001263332
NP_034833
Локус (UCSC) Хр. 4: 108.05 – 108.17 Mb Хр. 3: 131.11 – 131.22 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

LEF1 (англ. Lymphoid enhancer binding factor 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 4-ї хромосоми. [4] Довжина поліпептидного ланцюга білка становить 399 амінокислот, а молекулярна маса — 44 201[5].

Послідовність амінокислот
1020304050
MPQLSGGGGGGGGDPELCATDEMIPFKDEGDPQKEKIFAEISHPEEEGDL
ADIKSSLVNESEIIPASNGHEVARQAQTSQEPYHDKAREHPDDGKHPDGG
LYNKGPSYSSYSGYIMMPNMNNDPYMSNGSLSPPIPRTSNKVPVVQPSHA
VHPLTPLITYSDEHFSPGSHPSHIPSDVNSKQGMSRHPPAPDIPTFYPLS
PGGVGQITPPLGWQGQPVYPITGGFRQPYPSSLSVDTSMSRFSHHMIPGP
PGPHTTGIPHPAIVTPQVKQEHPHTDSDLMHVKPQHEQRKEQEPKRPHIK
KPLNAFMLYMKEMRANVVAECTLKESAAINQILGRRWHALSREEQAKYYE
LARKERQLHMQLYPGWSARDNYGKKKKRKREKLQESASGTGPRMTAAYI

Кодований геном білок за функціями належить до активаторів, фосфопротеїнів. Задіяний у таких біологічних процесах як транскрипція, регуляція транскрипції, сигнальний шлях Wnt, поліморфізм, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Waterman M.L., Fischer W.H., Jones K.A. (1991). A thymus-specific member of the HMG protein family regulates the human T cell receptor C alpha enhancer.. Genes Dev. 5: 656 — 669.  PubMed DOI:10.1101/gad.5.4.656
  • Hovanes K., Li T.W., Waterman M.L. (2000). The human LEF-1 gene contains a promoter preferentially active in lymphocytes and encodes multiple isoforms derived from alternative splicing.. Nucleic Acids Res. 28: 1994 — 2003.  PubMed DOI:10.1093/nar/28.9.1994
  • Jesse S., Koenig A., Ellenrieder V., Menke A. (2010). Lef-1 isoforms regulate different target genes and reduce cellular adhesion.. Int. J. Cancer 126: 1109 — 1120.  PubMed DOI:10.1002/ijc.24802
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Bruhn L., Munnerlyn A., Grosschedl R. (1997). ALY, a context-dependent coactivator of LEF-1 and AML-1, is required for TCRalpha enhancer function.. Genes Dev. 11: 640 — 653.  PubMed DOI:10.1101/gad.11.5.640
  • Brantjes H., Roose J., van De Wetering M., Clevers H. (2001). All Tcf HMG box transcription factors interact with Groucho-related co-repressors.. Nucleic Acids Res. 29: 1410 — 1419.  PubMed DOI:10.1093/nar/29.7.1410

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]