ATF4

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
ATF4
Ідентифікатори
Символи tax-responsive enhancer element-binding protein 67ATF4cAMP-responsive element-binding protein 2cAMP response element-binding protein 2TaxREB67cyclic AMP-dependent transcription factor ATF-4cyclic AMP-responsive element-binding protein 2DNA-binding protein TAXREB67tax-responsive enhancer element B67CREB-2cAMP-dependent transcription factor ATF-4
Зовнішні ІД GeneCards: [1]
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
н/д
н/д
RefSeq (білок)
н/д
н/д
Локус (UCSC) н/д н/д
PubMed search н/д н/д
Вікідані
Див./Ред. для людей

ATF4 (англ. Activating transcription factor 4) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 22-ї хромосоми.[1] Довжина поліпептидного ланцюга білка становить 351 амінокислот, а молекулярна маса — 38 590[2].

Послідовність амінокислот
1020304050
MTEMSFLSSEVLVGDLMSPFDQSGLGAEESLGLLDDYLEVAKHFKPHGFS
SDKAKAGSSEWLAVDGLVSPSNNSKEDAFSGTDWMLEKMDLKEFDLDALL
GIDDLETMPDDLLTTLDDTCDLFAPLVQETNKQPPQTVNPIGHLPESLTK
PDQVAPFTFLQPLPLSPGVLSSTPDHSFSLELGSEVDITEGDRKPDYTAY
VAMIPQCIKEEDTPSDNDSGICMSPESYLGSPQHSPSTRGSPNRSLPSPG
VLCGSARPKPYDPPGEKMVAAKVKGEKLDKKLKKMEQNKTAATRYRQKKR
AEQEALTGECKELEKKNEALKERADSLAKEIQYLKDLIEEVRKARGKKRV
P

Кодований геном білок за функціями належить до активаторів, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, біологічні ритми. Білок має сайт для зв'язування з ДНК. Локалізований у клітинній мембрані, цитоплазмі, цитоскелеті, ядрі, мембрані.

Література[ред. | ред. код]

  • Karpinski B.A., Morle G.D., Huggenvik J., Uhler M.D., Leiden J.M. (1992). Molecular cloning of human CREB-2: an ATF/CREB transcription factor that can negatively regulate transcription from the cAMP response element.. Proc. Natl. Acad. Sci. U.S.A. 89: 4820 — 4824.  PubMed DOI:10.1073/pnas.89.11.4820
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Hai T., Liu F., Coukos W.J., Green M.R. (1989). Transcription factor ATF cDNA clones: an extensive family of leucine zipper proteins able to selectively form DNA-binding heterodimers.. Genes Dev. 3: 2083 — 2090.  PubMed DOI:10.1101/gad.3.12b.2083
  • Ohoka N., Yoshii S., Hattori T., Onozaki K., Hayashi H. (2005). TRB3, a novel ER stress-inducible gene, is induced via ATF4-CHOP pathway and is involved in cell death.. EMBO J. 24: 1243 — 1255.  PubMed DOI:10.1038/sj.emboj.7600596
  • Su N., Kilberg M.S. (2008). C/EBP homology protein (CHOP) interacts with activating transcription factor 4 (ATF4) and negatively regulates the stress-dependent induction of the asparagine synthetase gene.. J. Biol. Chem. 283: 35106 — 35117.  PubMed DOI:10.1074/jbc.M806874200
  • Shoval Y., Berissi H., Kimchi A., Pietrokovski S. (2011). New modularity of DAP-kinases: alternative splicing of the DRP-1 gene produces a ZIPk-like isoform.. PLoS ONE 6: E17344 — E17344.  PubMed DOI:10.1371/journal.pone.0017344

Примітки[ред. | ред. код]

  1. HUGO Gene Nomenclature Commitee, HGNC:786 (англ.). Процитовано 12 вересня 2017. 
  2. UniProt, P18848 (англ.). Процитовано 12 вересня 2017. 

Див. також[ред. | ред. код]