IKZF3

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
IKZF3
Ідентифікатори
Символи IKZF3, AIO, AIOLOS, ZNFN1A3, IKAROS family zinc finger 3
Зовнішні ІД OMIM: 606221 MGI: 1342542 HomoloGene: 8269 GeneCards: IKZF3
Пов'язані генетичні захворювання
primary biliary cirrhosis[1]
Шаблон експресії
PBB GE IKZF3 221092 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_011771
RefSeq (білок)
NP_035901
Локус (UCSC) Хр. 17: 39.76 – 39.86 Mb Хр. 11: 98.46 – 98.55 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

IKZF3 (англ. IKAROS family zinc finger 3) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 17-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 509 амінокислот, а молекулярна маса — 58 023[5].

Послідовність амінокислот
1020304050
MEDIQTNAELKSTQEQSVPAESAAVLNDYSLTKSHEMENVDSGEGPANED
EDIGDDSMKVKDEYSERDENVLKSEPMGNAEEPEIPYSYSREYNEYENIK
LERHVVSFDSSRPTSGKMNCDVCGLSCISFNVLMVHKRSHTGERPFQCNQ
CGASFTQKGNLLRHIKLHTGEKPFKCHLCNYACQRRDALTGHLRTHSVEK
PYKCEFCGRSYKQRSSLEEHKERCRTFLQSTDPGDTASAEARHIKAEMGS
ERALVLDRLASNVAKRKSSMPQKFIGEKRHCFDVNYNSSYMYEKESELIQ
TRMMDQAINNAISYLGAEALRPLVQTPPAPTSEMVPVISSMYPIALTRAE
MSNGAPQELEKKSIHLPEKSVPSERGLSPNNSGHDSTDTDSNHEERQNHI
YQQNHMVLSRARNGMPLLKEVPRSYELLKPPPICPRDSVKVINKEGEVMD
VYRCDHCRVLFLDYVMFTIHMGCHGFRDPFECNMCGYRSHDRYEFSSHIA
RGEHRALLK

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном цинку, ДНК. Локалізований у цитоплазмі, ядрі.

Література[ред. | ред. код]

  • Hosokawa Y., Maeda Y., Takahashi E., Suzuki M., Seto M. (1999). Human aiolos, an ikaros-related zinc finger DNA binding protein: cDNA cloning, tissue expression pattern, and chromosomal mapping.. Genomics 61: 326 — 329.  PubMed DOI:10.1006/geno.1999.5949
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Romero F., Martinez-A C., Camonis J., Rebollo A. (1999). Aiolos transcription factor controls cell death in T cells by regulating Bcl-2 expression and its cellular localization.. EMBO J. 18: 3419 — 3430.  PubMed DOI:10.1093/emboj/18.12.3419
  • Perdomo J., Holmes M., Chong B., Crossley M. (2000). Eos and pegasus, two members of the Ikaros family of proteins with distinct DNA binding activities.. J. Biol. Chem. 275: 38347 — 38354.  PubMed DOI:10.1074/jbc.M005457200
  • Rebollo A., Ayllon V., Fleischer A., Martinez C.A., Zaballos A. (2001). The association of Aiolos transcription factor and Bcl-xL is involved in the control of apoptosis.. J. Immunol. 167: 6366 — 6373.  PubMed DOI:10.4049/jimmunol.167.11.6366

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]