JADE1

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
JADE1
Ідентифікатори
Символи JADE1, PHF17, jade family PHD finger 1
Зовнішні ІД OMIM: 610514 MGI: 1925835 HomoloGene: 18162 GeneCards: JADE1
Шаблон експресії
PBB GE PHF17 218517 at fs.png

PBB GE PHF17 gnf1h09361 s at fs.png

PBB GE PHF17 gnf1h01443 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001130184
NM_001130185
NM_001130186
NM_172303
RefSeq (білок)
NP_001123656
NP_001123657
NP_001123658
NP_758507
Локус (UCSC) Хр. 4: 128.81 – 128.88 Mb Хр. 3: 41.56 – 41.62 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

JADE1 (англ. Jade family PHD finger 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 4-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 842 амінокислот, а молекулярна маса — 95 533[4].

Послідовність амінокислот
1020304050
MKRGRLPSSSEDSDDNGSLSTTWSQNSRSQHRRSSCSRHEDRKPSEVFRT
DLITAMKLHDSYQLNPDEYYVLADPWRQEWEKGVQVPVSPGTIPQPVARV
VSEEKSLMFIRPKKYIVSSGSEPPELGYVDIRTLADSVCRYDLNDMDAAW
LELTNEEFKEMGMPELDEYTMERVLEEFEQRCYDNMNHAIETEEGLGIEY
DEDVVCDVCQSPDGEDGNEMVFCDKCNICVHQACYGILKVPEGSWLCRTC
ALGVQPKCLLCPKKGGAMKPTRSGTKWVHVSCALWIPEVSIGSPEKMEPI
TKVSHIPSSRWALVCSLCNEKFGASIQCSVKNCRTAFHVTCAFDRGLEMK
TILAENDEVKFKSYCPKHSSHRKPEESLGKGAAQENGAPECSPRNPLEPF
ASLEQNREEAHRVSVRKQKLQQLEDEFYTFVNLLDVARALRLPEEVVDFL
YQYWKLKRKVNFNKPLITPKKDEEDNLAKREQDVLFRRLQLFTHLRQDLE
RVRNLTYMVTRREKIKRSVCKVQEQIFNLYTKLLEQERVSGVPSSCSSSS
LENMLLFNSPSVGPDAPKIEDLKWHSAFFRKQMGTSLVHSLKKPHKRDPL
QNSPGSEGKTLLKQPDLCGRREGMVVPESFLGLEKTFAEARLISAQQKNG
VVMPDHGKRRDNRFHCDLIKGDLKDKSFKQSHKPLRSTDVSQRHLDNTRA
ATSPGVGQSAPGTRKEIVPKCNGSLIKVNYNQTAVKVPTTPASPVKNWGG
FRIPKKGERQQQGEAHDGACHQHSDYPYLGLGRVPAKERAKSKLKSDNEN
DGYVPDVEMSDSESEASEKKCIHTSSTISRRTDIIRRSILAS

Кодований геном білок за функціями належить до активаторів, фосфопротеїнів. Задіяний у таких біологічних процесах як апоптоз, транскрипція, регуляція транскрипції, поліморфізм, ацетиляція, альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном цинку. Локалізований у цитоплазмі, цитоскелеті, ядрі, клітинних відростках.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Nagase T., Nakayama M., Nakajima D., Kikuno R., Ohara O. (2001). Prediction of the coding sequences of unidentified human genes. XX. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.. DNA Res. 8: 85 — 95.  PubMed DOI:10.1093/dnares/8.2.85
  • Tzouanacou E., Tweedie S., Wilson V. (2003). Identification of Jade1, a gene encoding a PHD zinc finger protein, in a gene trap mutagenesis screen for genes involved in anteroposterior axis development.. Mol. Cell. Biol. 23: 8553 — 8562.  PubMed DOI:10.1128/MCB.23.23.8553-8562.2003
  • Panchenko M.V., Zhou M.I., Cohen H.T. (2004). von Hippel-Lindau partner Jade-1 is a transcriptional co-activator associated with histone acetyltransferase activity.. J. Biol. Chem. 279: 56032 — 56041.  PubMed DOI:10.1074/jbc.M410487200

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:30027 (англ.). Процитовано 30 серпня 2017. 
  4. UniProt, Q6IE81 (англ.). Процитовано 30 серпня 2017. 

Див. також[ред. | ред. код]