HOXC6

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
HOXC6
Protein HOXC6 PDB 1ahd.png
Ідентифікатори
Символи HOXC6, CP25, HHO.C8, HOX3, HOX3C, homeobox C6
Зовнішні ІД OMIM: 142972 MGI: 96197 HomoloGene: 19533 GeneCards: HOXC6
Шаблон експресії
PBB GE HOXC6 206858 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_153693
NM_004503
NM_010465
RefSeq (білок)
NP_004494
NP_710160
NP_034595
Локус (UCSC) Хр. 12: 53.99 – 54.03 Mb Хр. 15: 103 – 103.01 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

HOXC6 (англ. Homeobox C6) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 12-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 235 амінокислот, а молекулярна маса — 26 915[4].

Послідовність амінокислот
1020304050
MNSYFTNPSLSCHLAGGQDVLPNVALNSTAYDPVRHFSTYGAAVAQNRIY
STPFYSPQENVVFSSSRGPYDYGSNSFYQEKDMLSNCRQNTLGHNTQTSI
AQDFSSEQGRTAPQDQKASIQIYPWMQRMNSHSGVGYGADRRRGRQIYSR
YQTLELEKEFHFNRYLTRRRRIEIANALCLTERQIKIWFQNRRMKWKKES
NLTSTLSGGGGGATADSLGGKEEKREETEEEKQKE

Кодований геном білок за функцією належить до білків розвитку. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Simeone A., Pannese M., Acampora D., D'Esposito M., Boncinelli E. (1988). At least three human homeoboxes on chromosome 12 belong to the same transcription unit.. Nucleic Acids Res. 16: 5379 — 5390.  PubMed DOI:10.1093/nar/16.12.5379
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:5128 (англ.). Процитовано 11 вересня 2017. 
  4. UniProt, P09630 (англ.). Процитовано 11 вересня 2017. 

Див. також[ред. | ред. код]