TBX5

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
TBX5
Protein TBX5 PDB 2X6U.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи TBX5, HOS, T-box 5, T-box transcription factor 5
Зовнішні ІД OMIM: 601620 MGI: 102541 HomoloGene: 160 GeneCards: TBX5
Пов'язані генетичні захворювання
Holt-Oram syndrome[1]
Шаблон експресії
PBB GE TBX5 211886 s at fs.png

PBB GE TBX5 207155 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_181486
NM_000192
NM_080717
NM_080718
NM_011537
RefSeq (білок)
NP_000183
NP_542448
NP_852259
NP_035667
Локус (UCSC) Хр. 12: 114.35 – 114.41 Mb Хр. 5: 119.83 – 119.89 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

TBX5 (англ. T-box 5) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 12-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 518 амінокислот, а молекулярна маса — 57 711[5].

Послідовність амінокислот
1020304050
MADADEGFGLAHTPLEPDAKDLPCDSKPESALGAPSKSPSSPQAAFTQQG
MEGIKVFLHERELWLKFHEVGTEMIITKAGRRMFPSYKVKVTGLNPKTKY
ILLMDIVPADDHRYKFADNKWSVTGKAEPAMPGRLYVHPDSPATGAHWMR
QLVSFQKLKLTNNHLDPFGHIILNSMHKYQPRLHIVKADENNGFGSKNTA
FCTHVFPETAFIAVTSYQNHKITQLKIENNPFAKGFRGSDDMELHRMSRM
QSKEYPVVPRSTVRQKVASNHSPFSSESRALSTSSNLGSQYQCENGVSGP
SQDLLPPPNPYPLPQEHSQIYHCTKRKEEECSTTDHPYKKPYMETSPSEE
DSFYRSSYPQQQGLGASYRTESAQRQACMYASSAPPSEPVPSLEDISCNT
WPSMPSYSSCTVTTVQPMDRLPYQHFSAHFTSGPLVPRLAGMANHGSPQL
GEGMFQHQTSVAHQPVVRQCGPQTGLQSPGTLQPPEFLYSHGVPRTLSPH
QYHSVHGVGMVPEWSDNS

Кодований геном білок за функцією належить до білків розвитку. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Gruenauer-Kloevekorn C., Froster U.G. (2003). Holt-Oram syndrome: a new mutation in the TBX5 gene in two unrelated families.. Ann. Genet. 46: 19 — 23.  PubMed DOI:10.1016/S0003-3995(03)00006-6
  • Stirnimann C.U., Ptchelkine D., Grimm C., Muller C.W. (2010). Structural basis of TBX5-DNA recognition: the T-box domain in its DNA-bound and -unbound form.. J. Mol. Biol. 400: 71 — 81.  PubMed DOI:10.1016/j.jmb.2010.04.052

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]