PHF10

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
PHF10
Ідентифікатори
Символи PHF10, BAF45A, XAP135, PHD finger protein 10
Зовнішні ІД OMIM: 613069 MGI: 1919307 HomoloGene: 10112 GeneCards: PHF10
Шаблон експресії
PBB GE PHF10 219126 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_133325
NM_018288
NM_024250
NM_001360983
RefSeq (білок)
NP_060758
NP_579866
NP_077212
NP_001347912
Локус (UCSC) Хр. 6: 169.7 – 169.73 Mb Хр. 17: 14.95 – 14.96 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

PHF10 (англ. PHD finger protein 10) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 6-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 498 амінокислот, а молекулярна маса — 56 051[4].

Послідовність амінокислот
1020304050
MAAAAGPGAALSPRPCDSDPATPGAQSPKDDNEDNSNDGTQPSKRRRMGS
GDSSRSCETSSQDLGFSYYPAENLIEYKWPPDETGEYYMLQEQVSEYLGV
TSFKRKYPDLERRDLSHKEKLYLRELNVITETQCTLGLTALRSDEVIDLM
IKEYPAKHAEYSVILQEKERQRITDHYKEYSQMQQQNTQKVEASKVPEYI
KKAAKKAAEFNSNLNRERMEERRAYFDLQTHVIQVPQGKYKVLPTERTKV
SSYPVALIPGQFQEYYKRYSPDELRYLPLNTALYEPPLDPELPALDSDGD
SDDGEDGRGDEKRKNKGTSDSSSGNVSEGESPPDSQEDSFQGRQKSKDKA
ATPRKDGPKRSVLSKSVPGYKPKVIPNAICGICLKGKESNKKGKAESLIH
CSQCENSGHPSCLDMTMELVSMIKTYPWQCMECKTCIICGQPHHEEEMMF
CDMCDRGYHTFCVGLGAIPSGRWICDCCQRAPPTPRKVGRRGKNSKEG

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, нейрогенез, ацетилювання, альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном цинку. Локалізований у ядрі.

Література[ред. | ред. код]

  • Banga S.S., Peng L., Dasgupta T., Palejwala V., Ozer H.L. (2009). PHF10 is required for cell proliferation in normal and SV40-immortalized human fibroblast cells.. Cytogenet. Genome Res. 126: 227 — 242.  PubMed DOI:10.1159/000251960
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:18250 (англ.). Процитовано 6 вересня 2017. 
  4. UniProt, Q8WUB8 (англ.). Процитовано 6 вересня 2017. 

Див. також[ред. | ред. код]