ARNTL

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
ARNTL
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи ARNTL, BMAL1, BMAL1c, JAP3, MOP3, PASD3, TIC, bHLHe5, aryl hydrocarbon receptor nuclear translocator like
Зовнішні ІД OMIM: 602550 MGI: 1096381 HomoloGene: 910 GeneCards: ARNTL
Пов'язані генетичні захворювання
шизофренія[1]
Шаблон експресії
PBB GE ARNTL 209824 s at fs.png

PBB GE ARNTL 210971 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001243048
NM_007489
NM_001357070
NM_001368412
RefSeq (білок)
NP_001229977
NP_031515
NP_001343999
NP_001355341
Локус (UCSC) н/д Хр. 7: 113.21 – 113.31 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

ARNTL (англ. Aryl hydrocarbon receptor nuclear translocator like) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 11-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 626 амінокислот, а молекулярна маса — 68 762[5].

Послідовність амінокислот
1020304050
MADQRMDISSTISDFMSPGPTDLLSSSLGTSGVDCNRKRKGSSTDYQESM
DTDKDDPHGRLEYTEHQGRIKNAREAHSQIEKRRRDKMNSFIDELASLVP
TCNAMSRKLDKLTVLRMAVQHMKTLRGATNPYTEANYKPTFLSDDELKHL
ILRAADGFLFVVGCDRGKILFVSESVFKILNYSQNDLIGQSLFDYLHPKD
IAKVKEQLSSSDTAPRERLIDAKTGLPVKTDITPGPSRLCSGARRSFFCR
MKCNRPSVKVEDKDFPSTCSKKKADRKSFCTIHSTGYLKSWPPTKMGLDE
DNEPDNEGCNLSCLVAIGRLHSHVVPQPVNGEIRVKSMEYVSRHAIDGKF
VFVDQRATAILAYLPQELLGTSCYEYFHQDDIGHLAECHRQVLQTREKIT
TNCYKFKIKDGSFITLRSRWFSFMNPWTKEVEYIVSTNTVVLANVLEGGD
PTFPQLTASPHSMDSMLPSGEGGPKRTHPTVPGIPGGTRAGAGKIGRMIA
EEIMEIHRIRGSSPSSCGSSPLNITSTPPPDASSPGGKKILNGGTPDIPS
SGLLSGQAQENPGYPYSDSSSILGENPHIGIDMIDNDQGSSSPSNDEAAM
AVIMSLLEADAGLGGPVDFSDLPWPL

Кодований геном білок за функціями належить до активаторів, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, біологічні ритми, ацетилювання, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у цитоплазмі, ядрі.

Література[ред. | ред. код]

  • Ikeda M., Nomura M. (1997). cDNA cloning and tissue-specific expression of a novel basic helix-loop-helix/PAS protein (BMAL1) and identification of alternatively spliced variants with alternative translation initiation site usage.. Biochem. Biophys. Res. Commun. 233: 258 — 264.  PubMed DOI:10.1006/bbrc.1997.6371
  • Hogenesch J.B., Gu Y.Z., Jain S., Bradfield C.A. (1998). The basic-helix-loop-helix-PAS orphan MOP3 forms transcriptionally active complexes with circadian and hypoxia factors.. Proc. Natl. Acad. Sci. U.S.A. 95: 5474 — 5479.  PubMed DOI:10.1073/pnas.95.10.5474
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Rutter J., Reick M., Wu L.C., McKnight S.L. (2001). Regulation of clock and NPAS2 DNA binding by the redox state of NAD cofactors.. Science 293: 510 — 514.  PubMed DOI:10.1126/science.1060698
  • Richards J., Gumz M.L. (2013). Mechanism of the circadian clock in physiology.. Am. J. Physiol. 304: R1053 — R1064.  PubMed DOI:10.1152/ajpregu.00066.2013
  • Eckel-Mahan K., Sassone-Corsi P. (2013). Metabolism and the circadian clock converge.. Physiol. Rev. 93: 107 — 135.  PubMed DOI:10.1152/physrev.00016.2012

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]