FOXK2

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
FOXK2
Protein FOXK2 PDB 1jxs.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи FOXK2, ILF, ILF-1, ILF1, forkhead box K2, nGTBP
Зовнішні ІД OMIM: 147685 MGI: 1916087 HomoloGene: 18748 GeneCards: FOXK2
Шаблон експресії
PBB GE FOXK2 203064 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_004514
NM_181430
NM_181431
NM_001080932
NM_001363033
RefSeq (білок)
NP_004505
NP_001074401
NP_001349962
Локус (UCSC) Хр. 17: 82.52 – 82.64 Mb Хр. 11: 121.26 – 121.31 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

FOXK2 (англ. Forkhead box K2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 17-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 660 амінокислот, а молекулярна маса — 69 062[4].

Послідовність амінокислот
1020304050
MAAAAAALSGAGTPPAGGGAGGGGAGGGGSPPGGWAVARLEGREFEYLMK
KRSVTIGRNSSQGSVDVSMGHSSFISRRHLEIFTPPGGGGHGGAAPELPP
AQPRPDAGGDFYLRCLGKNGVFVDGVFQRRGAPPLQLPRVCTFRFPSTNI
KITFTALSSEKREKQEASESPVKAVQPHISPLTINIPDTMAHLISPLPSP
TGTISAANSCPSSPRGAGSSGYKVGRVMPSDLNLMADNSQPENEKEASGG
DSPKDDSKPPYSYAQLIVQAITMAPDKQLTLNGIYTHITKNYPYYRTADK
GWQNSIRHNLSLNRYFIKVPRSQEEPGKGSFWRIDPASESKLIEQAFRKR
RPRGVPCFRTPLGPLSSRSAPASPNHAGVLSAHSSGAQTPESLSREGSPA
PLEPEPGAAQPKLAVIQEARFAQSAPGSPLSSQPVLITVQRQLPQAIKPV
TYTVATPVTTSTSQPPVVQTVHVVHQIPAVSVTSVAGLAPANTYTVSGQA
VVTPAAVLAPPKAEAQENGDHREVKVKVEPIPAIGHATLGTASRIIQTAQ
TTPVQTVTIVQQAPLGQHQLPIKTVTQNGTHVASVPTAVHGQVNNAAASP
LHMLATHASASASLPTKRHNGDQPEQPELKRIKTEDGEGIVIALSVDTPP
AAVREKGVQN

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, ацетилювання, альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, ДНК, іоном магнію. Локалізований у ядрі.

Література[ред. | ред. код]

  • Li C., Lai C., Sigman D.S., Gaynor R.B. (1991). Cloning of a cellular factor, interleukin binding factor, that binds to NFAT-like motifs in the human immunodeficiency virus long terminal repeat.. Proc. Natl. Acad. Sci. U.S.A. 88: 7739 — 7743.  PubMed DOI:10.1073/pnas.88.17.7739
  • Li C., Lusis A.J., Sparkes R., Nirula A., Gaynor R.B. (1992). Characterization and chromosomal mapping of the gene encoding the cellular DNA binding protein ILF.. Genomics 13: 665 — 671.  PubMed DOI:10.1016/0888-7543(92)90139-J

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:6036 (англ.). Процитовано 12 вересня 2017. 
  4. UniProt, Q01167 (англ.). Процитовано 12 вересня 2017. 

Див. також[ред. | ред. код]