TWIST1

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
TWIST1
Ідентифікатори
Символи twist basic helix-loop-helix transcription factor 1twist homolog 1H-twisttwist-related protein 1TWIST homolog of drosophilabHLHa38class A basic helix-loop-helix protein 38TWIST1B-HLH DNA binding protein
Зовнішні ІД GeneCards: [1]
Шаблон експресії
PBB GE TWIST1 213943 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
н/д
н/д
RefSeq (білок)
н/д
н/д
Локус (UCSC) н/д н/д
PubMed search н/д н/д
Вікідані
Див./Ред. для людей

TWIST1 (англ. Twist family bHLH transcription factor 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 7-ї хромосоми.[1] Довжина поліпептидного ланцюга білка становить 202 амінокислот, а молекулярна маса — 20 954[2].

Послідовність амінокислот
1020304050
MMQDVSSSPVSPADDSLSNSEEEPDRQQPPSGKRGGRKRRSSRRSAGGGA
GPGGAAGGGVGGGDEPGSPAQGKRGKKSAGCGGGGGAGGGGGSSSGGGSP
QSYEELQTQRVMANVRERQRTQSLNEAFAALRKIIPTLPSDKLSKIQTLK
LAARYIDFLYQVLQSDELDSKMASCSYVAHERLSYAFSVWRMEGAWSMSA
SH

Кодований геном білок за функціями належить до репресорів, активаторів, білків розвитку. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, біологічні ритми, диференціація клітин, міогенез. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Bourgeois P., Stoetzel C., Bolcato-Bellemin A.-L., Mattei M.-G., Perrin-Schmitt F. (1996). The human H-twist gene is located at 7p21 and encodes a B-HLH protein that is 96% similar to its murine M-twist counterpart.. Mamm. Genome 7: 915 — 917.  PubMed DOI:10.1007/s003359900269
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Sosic D., Richardson J.A., Yu K., Ornitz D.M., Olson E.N. (2003). Twist regulates cytokine gene expression through a negative feedback loop that represses NF-kappaB activity.. Cell 112: 169 — 180.  PubMed DOI:10.1016/S0092-8674(03)00002-3
  • Seto M.L., Lee S.J., Sze R.W., Cunningham M.L. (2001). Another TWIST on Baller-Gerold syndrome.. Am. J. Med. Genet. 104: 323 — 330.  PubMed DOI:10.1002/ajmg.10065
  • Kunz J., Hudler M., Fritz B. (1999). Identification of a frameshift mutation in the gene TWIST in a family affected with Robinow-Sorauf syndrome.. J. Med. Genet. 36: 650 — 652.  PubMed

Примітки[ред. | ред. код]

  1. HUGO Gene Nomenclature Commitee, HGNC:12428 (англ.). Процитовано 7 вересня 2017. 
  2. UniProt, Q15672 (англ.). Процитовано 7 вересня 2017. 

Див. також[ред. | ред. код]