ILF3

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
ILF3
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи ILF3, CBTF, DRBF, DRBP76, MMP4, MPHOSPH4, MPP4, NF-AT-90, NF110, NF110b, NF90, NF90a, NF90b, NFAR, NFAR-1, NFAR2, TCP110, TCP80, interleukin enhancer binding factor 3, NFAR110, MPP4110, NFAR-2, NF90c, NFAR90, NF90ctv
Зовнішні ІД OMIM: 603182 MGI: 1339973 HomoloGene: 7785 GeneCards: ILF3
Пов'язані генетичні захворювання
Ожиріння[1]
Шаблон експресії
PBB GE ILF3 217805 at fs.png

PBB GE ILF3 211375 s at fs.png

PBB GE ILF3 208930 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001137673
NM_004516
NM_012218
NM_017620
NM_153464
RefSeq (білок)
NP_001131145
NP_004507
NP_036350
NP_060090
NP_703194
Локус (UCSC) Хр. 19: 10.65 – 10.69 Mb Хр. 9: 21.37 – 21.41 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

ILF3 (англ. Interleukin enhancer binding factor 3) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 19-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 894 амінокислот, а молекулярна маса — 95 338[5].

Послідовність амінокислот
1020304050
MRPMRIFVNDDRHVMAKHSSVYPTQEELEAVQNMVSHTERALKAVSDWID
EQEKGSSEQAESDNMDVPPEDDSKEGAGEQKTEHMTRTLRGVMRVGLVAK
GLLLKGDLDLELVLLCKEKPTTALLDKVADNLAIQLAAVTEDKYEILQSV
DDAAIVIKNTKEPPLSLTIHLTSPVVREEMEKVLAGETLSVNDPPDVLDR
QKCLAALASLRHAKWFQARANGLKSCVIVIRVLRDLCTRVPTWGPLRGWP
LELLCEKSIGTANRPMGAGEALRRVLECLASGIVMPDGSGIYDPCEKEAT
DAIGHLDRQQREDITQSAQHALRLAAFGQLHKVLGMDPLPSKMPKKPKNE
NPVDYTVQIPPSTTYAITPMKRPMEEDGEEKSPSKKKKKIQKKEEKAEPP
QAMNALMRLNQLKPGLQYKLVSQTGPVHAPIFTMSVEVDGNSFEASGPSK
KTAKLHVAVKVLQDMGLPTGAEGRDSSKGEDSAEETEAKPAVVAPAPVVE
AVSTPSAAFPSDATAEQGPILTKHGKNPVMELNEKRRGLKYELISETGGS
HDKRFVMEVEVDGQKFQGAGSNKKVAKAYAALAALEKLFPDTPLALDANK
KKRAPVPVRGGPKFAAKPHNPGFGMGGPMHNEVPPPPNLRGRGRGGSIRG
RGRGRGFGGANHGGYMNAGAGYGSYGYGGNSATAGYSQFYSNGGHSGNAS
GGGGGGGGGSSGYGSYYQGDNYNSPVPPKHAGKKQPHGGQQKPSYGSGYQ
SHQGQQQSYNQSPYSNYGPPQGKQKGYNHGQGSYSYSNSYNSPGGGGGSD
YNYESKFNYSGSGGRSGGNSYGSGGASYNPGSHGGYGGGSGGGSSYQGKQ
GGYSQSNYNSPGSGQNYSGPPSSYQSSQGGYGRNADHSMNYQYR

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, противірусний захист, ацетилювання, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК, РНК. Локалізований у цитоплазмі, ядрі.

Література[ред. | ред. код]

  • Xu Y.-H., Grabowski G.A. (1999). Molecular cloning and characterization of a translational inhibitory protein that binds to coding sequences of human acid beta-glucosidase and other mRNAs.. Mol. Genet. Metab. 68: 441 — 454.  PubMed DOI:10.1006/mgme.1999.2934
  • Duchange N., Pidoux J., Camus E., Sauvaget D. (2000). Alternative splicing in the human interleukin enhancer binding factor 3 (ILF3) gene.. Gene 261: 345 — 353.  PubMed DOI:10.1016/S0378-1119(00)00495-9
  • Saunders L.R., Jurecic V., Barber G.N. (2001). The 90- and 110-kDa human NFAR proteins are translated from two differentially spliced mRNAs encoded on chromosome 19p13.. Genomics 71: 256 — 259.  PubMed DOI:10.1006/geno.2000.6423
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Matsumoto-Taniura N., Pirollet F., Monroe R., Gerace L., Westendorf J.M. (1996). Identification of novel M phase phosphoproteins by expression cloning.. Mol. Biol. Cell 7: 1455 — 1469.  PubMed DOI:10.1091/mbc.7.9.1455
  • Ting N.S.Y., Kao P.N., Chan D.W., Lintott L.G., Lees-Miller S.P. (1998). DNA-dependent protein kinase interacts with antigen receptor response element binding proteins NF90 and NF45.. J. Biol. Chem. 273: 2136 — 2145.  PubMed DOI:10.1074/jbc.273.4.2136

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]