MEF2D

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
MEF2D
Protein MEF2D PDB 1c7u.png
Ідентифікатори
Символи MEF2D, myocyte enhancer factor 2D
Зовнішні ІД OMIM: 600663 MGI: 99533 HomoloGene: 4327 GeneCards: MEF2D
Пов'язані генетичні захворювання
Мігрень[1]
Шаблон експресії
PBB GE MEF2D 203004 s at fs.png

PBB GE MEF2D 203003 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001271629
NM_005920
NM_133665
NM_001310587
NM_001310593
RefSeq (білок)
NP_001258558
NP_005911
NP_001297516
NP_001297522
NP_598426
Локус (UCSC) Хр. 1: 156.46 – 156.5 Mb Хр. 3: 88.14 – 88.17 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

MEF2D (англ. Myocyte enhancer factor 2D) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 1-ї хромосоми. [4] Довжина поліпептидного ланцюга білка становить 521 амінокислот, а молекулярна маса — 55 938[5].

Послідовність амінокислот
1020304050
MGRKKIQIQRITDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNH
SNKLFQYASTDMDKVLLKYTEYNEPHESRTNADIIETLRKKGFNGCDSPE
PDGEDSLEQSPLLEDKYRRASEELDGLFRRYGSTVPAPNFAMPVTVPVSN
QSSLQFSNPSGSLVTPSLVTSSLTDPRLLSPQQPALQRNSVSPGLPQRPA
SAGAMLGGDLNSANGACPSPVGNGYVSARASPGLLPVANGNSLNKVIPAK
SPPPPTHSTQLGAPSRKPDLRVITSQAGKGLMHHLTEDHLDLNNAQRLGV
SQSTHSLTTPVVSVATPSLLSQGLPFSSMPTAYNTDYQLTSAELSSLPAF
SSPGGLSLGNVTAWQQPQQPQQPQQPQPPQQQPPQPQQPQPQQPQQPQQP
PQQQSHLVPVSLSNLIPGSPLPHVGAALTVTTHPHISIKSEPVSPSRERS
PAPPPPAVFPAARPEPGDGLSSPAGGSYETGDRDDGRGDFGPTLGLLRPA
PEPEAEGSAVKRMRLDTWTLK

Кодований геном білок за функціями належить до активаторів, білків розвитку, фосфопротеїнів. Задіяний у таких біологічних процесах як апоптоз, транскрипція, регуляція транскрипції, диференціація, нейрогенез, ацетиляція. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Blaeser F., Ho N., Prywes R., Chatila T.A. (2000). Ca(2+)-dependent gene expression mediated by MEF2 transcription factors.. J. Biol. Chem. 275: 197 — 209.  PubMed DOI:10.1074/jbc.275.1.197
  • Zhu B., Ramachandran B., Gulick T. (2005). Alternative pre-mRNA splicing governs expression of a conserved acidic transactivation domain in myocyte enhancer factor 2 factors of striated muscle and brain.. J. Biol. Chem. 280: 28749 — 28760.  PubMed DOI:10.1074/jbc.M502491200
  • Gregoire S., Yang X.-J. (2005). Association with class IIa histone deacetylases upregulates the sumoylation of MEF2 transcription factors.. Mol. Cell. Biol. 25: 2273 — 2287.  PubMed DOI:10.1128/MCB.25.6.2273-2287.2005
  • Zhao X., Sternsdorf T., Bolger T.A., Evans R.M., Yao T.-P. (2005). Regulation of MEF2 by histone deacetylase 4- and SIRT1 deacetylase-mediated lysine modifications.. Mol. Cell. Biol. 25: 8456 — 8464.  PubMed DOI:10.1128/MCB.25.19.8456-8464.2005
  • Ma K., Chan J.K., Zhu G., Wu Z. (2005). Myocyte enhancer factor 2 acetylation by p300 enhances its DNA binding activity, transcriptional activity, and myogenic differentiation.. Mol. Cell. Biol. 25: 3575 — 3582.  PubMed DOI:10.1128/MCB.25.9.3575-3582.2005

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]