NR1H2

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
NR1H2
Protein NR1H2 PDB 1p8d.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи NR1H2, LXR-b, LXRB, NER, NER-I, RIP15, UNR, Liver X receptor beta, nuclear receptor subfamily 1 group H member 2
Зовнішні ІД OMIM: 600380 MGI: 1352463 HomoloGene: 21397 GeneCards: NR1H2
Реагує на сполуку
(25R)-cholest-5-ene-3β,26-diol, desmosterol[1]
Шаблон експресії
PBB GE NR1H2 218215 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_007121
NM_001256647
NM_001285517
NM_001285518
NM_001285519
NM_009473
RefSeq (білок)
NP_001243576
NP_009052
NP_009052.3
NP_001272446
NP_001272447
NP_001272448
NP_033499
Локус (UCSC) Хр. 19: 50.33 – 50.38 Mb Хр. 7: 44.55 – 44.55 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

NR1H2 (англ. Nuclear receptor subfamily 1 group H member 2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 19-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 460 амінокислот, а молекулярна маса — 50 974[5].

Послідовність амінокислот
1020304050
MSSPTTSSLDTPLPGNGPPQPGAPSSSPTVKEEGPEPWPGGPDPDVPGTD
EASSACSTDWVIPDPEEEPERKRKKGPAPKMLGHELCRVCGDKASGFHYN
VLSCEGCKGFFRRSVVRGGARRYACRGGGTCQMDAFMRRKCQQCRLRKCK
EAGMREQCVLSEEQIRKKKIRKQQQESQSQSQSPVGPQGSSSSASGPGAS
PGGSEAGSQGSGEGEGVQLTAAQELMIQQLVAAQLQCNKRSFSDQPKVTP
WPLGADPQSRDARQQRFAHFTELAIISVQEIVDFAKQVPGFLQLGREDQI
ALLKASTIEIMLLETARRYNHETECITFLKDFTYSKDDFHRAGLQVEFIN
PIFEFSRAMRRLGLDDAEYALLIAINIFSADRPNVQEPGRVEALQQPYVE
ALLSYTRIKRPQDQLRFPRMLMKLVSLRTLSSVHSEQVFALRLQDKKLPP
LLSEIWDVHE

Кодований геном білок за функціями належить до рецепторів, активаторів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном цинку, ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]