ELF4

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
ELF4
Ідентифікатори
Символи ELF4, ELFR, MEF, E74 like ETS transcription factor 4
Зовнішні ІД OMIM: 300775 MGI: 1928377 HomoloGene: 31036 GeneCards: ELF4
Шаблон експресії
PBB GE ELF4 203490 at fs.png

PBB GE ELF4 31845 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001127197
NM_001421
NM_019680
RefSeq (білок)
NP_001120669
NP_001412
NP_062654
Локус (UCSC) Хр. X: 130.06 – 130.11 Mb Хр. X: 48.41 – 48.46 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

ELF4 (англ. E74 like ETS transcription factor 4) – білок, який кодується однойменним геном, розташованим у людей на X-хромосомі.[3] Довжина поліпептидного ланцюга білка становить 663 амінокислот, а молекулярна маса — 70 730[4].

Послідовність амінокислот
1020304050
MAITLQPSDLIFEFASNGMDDDIHQLEDPSVFPAVIVEQVPYPDLLHLYS
GLELDDVHNGIITDGTLCMTQDQILEGSFLLTDDNEATSHTMSTAEVLLN
MESPSDILDEKQIFSTSEMLPDSDPAPAVTLPNYLFPASEPDALNRAGDT
SDQEGHSLEEKASREESAKKTGKSKKRIRKTKGNRSTSPVTDPSIPIRKK
SKDGKGSTIYLWEFLLALLQDRNTCPKYIKWTQREKGIFKLVDSKAVSKL
WGKQKNKPDMNYETMGRALRYYYQRGILAKVEGQRLVYQFKEMPKDLVVI
EDEDESSEATAAPPQASTASVASASTTRRTSSRVSSRSAPQGKGSSSWEK
PKIQHVGLQPSASLELGPSLDEEIPTTSTMLVSPAEGQVKLTKAVSASSV
PSNIHLGVAPVGSGSALTLQTIPLTTVLTNGPPASTTAPTQLVLQSVPAA
STFKDTFTLQASFPLNASFQDSQVAAPGAPLILSGLPQLLAGANRPTNPA
PPTVTGAGPAGPSSQPPGTVIAAFIRTSGTTAAPRVKEGPLRSSSYVQGM
VTGAPMEGLLVPEETLRELLRDQAHLQPLPTQVVSRGSHNPSLLGNQTLS
PPSRPTVGLTPVAELELSSGSGSLLMAEPSVTTSGSLLTRSPTPAPFSPF
NPTSLIKMEPHDI

Кодований геном білок за функціями належить до активаторів, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Mao S., Frank R.C., Zhang J., Miyazaki Y., Nimer S.D. (1999). Functional and physical interactions between AML1 proteins and an ETS protein, MEF: implications for the pathogenesis of t(8;21)-positive leukemias.. Mol. Cell. Biol. 19: 3635 — 3644.  PubMed DOI:10.1128/MCB.19.5.3635
  • Hedvat C.V., Yao J., Sokolic R.A., Nimer S.D. (2004). Myeloid ELF1-like factor is a potent activator of interleukin-8 expression in hematopoietic cells.. J. Biol. Chem. 279: 6395 — 6400.  PubMed DOI:10.1074/jbc.M307524200
  • Miyazaki Y., Sun X., Uchida H., Zhang J., Nimer S. (1996). MEF, a novel transcription factor with an Elf-1 like DNA binding domain but distinct transcriptional activating properties.. Oncogene 13: 1721 — 1729.  PubMed

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:3319 (англ.). Процитовано 12 вересня 2017. 
  4. UniProt, Q99607 (англ.). Процитовано 12 вересня 2017. 

Див. також[ред. | ред. код]