MEF2C

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
MEF2C
Protein MEF2C PDB 1c7u.png
Ідентифікатори
Символи MEF2C, C5DELq14.3, DEL5q14.3, myocyte enhancer factor 2C
Зовнішні ІД OMIM: 600662 MGI: 99458 HomoloGene: 31087 GeneCards: MEF2C
Пов'язані генетичні захворювання
mental retardation, autosomal dominant 20[1]
Шаблон експресії
PBB GE MEF2C 209200 at fs.png

PBB GE MEF2C 207968 s at fs.png

PBB GE MEF2C 209199 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001170537
NM_025282
RefSeq (білок)
Локус (UCSC) Хр. 5: 88.72 – 88.9 Mb н/д
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

MEF2C (англ. Myocyte enhancer factor 2C) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 5-ї хромосоми. [4] Довжина поліпептидного ланцюга білка становить 473 амінокислот, а молекулярна маса — 51 221[5].

Послідовність амінокислот
1020304050
MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNS
TNKLFQYASTDMDKVLLKYTEYNEPHESRTNSDIVETLRKKGLNGCDSPD
PDADDSVGHSPESEDKYRKINEDIDLMISRQRLCAVPPPNFEMPVSIPVS
SHNSLVYSNPVSSLGNPNLLPLAHPSLQRNSMSPGVTHRPPSAGNTGGLM
GGDLTSGAGTSAGNGYGNPRNSPGLLVSPGNLNKNMQAKSPPPMNLGMNN
RKPDLRVLIPPGSKNTMPSVSEDVDLLLNQRINNSQSAQSLATPVVSVAT
PTLPGQGMGGYPSAISTTYGTEYSLSSADLSSLSGFNTASALHLGSVTGW
QQQHLHNMPPSALSQLGACTSTHLSQSSNLSLPSTQSLNIKSEPVSPPRD
RTTTPSRYPQHTRHEAGRSPVDSLSSCSSSYDGSDREDHRNEFHSPIGLT
RPSPDERESPSVKRMRLSEGWAT

Кодований геном білок за функціями належить до активаторів, білків розвитку, фосфопротеїнів. Задіяний у таких біологічних процесах як апоптоз, транскрипція, регуляція транскрипції, диференціація, нейрогенез, ацетилювання, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Han J., Jiang Y., Li Z., Kravchenko V.V., Ulevitch R.J. (1997). Activation of the transcription factor MEF2C by the MAP kinase p38 in inflammation.. Nature 386: 296 — 299.  PubMed DOI:10.1038/386296a0
  • Swanson B.J., Jaeck H.-M., Lyons G.E. (1998). Characterization of myocyte enhancer factor 2 (MEF2) expression in B and T cells: MEF2C is a B cell-restricted transcription factor in lymphocytes.. Mol. Immunol. 35: 445 — 458.  PubMed DOI:10.1016/S0161-5890(98)00058-3
  • Zhou X., Marks P.A., Rifkind R.A., Richon V.M. (2001). Cloning and characterization of a histone deacetylase, HDAC9.. Proc. Natl. Acad. Sci. U.S.A. 98: 10572 — 10577.  PubMed DOI:10.1073/pnas.191375098
  • Zhu B., Gulick T. (2004). Phosphorylation and alternative pre-mRNA splicing converge to regulate myocyte enhancer factor 2C activity.. Mol. Cell. Biol. 24: 8264 — 8275.  PubMed DOI:10.1128/MCB.24.18.8264-8275.2004
  • Gocke C.B., Yu H., Kang J. (2005). Systematic identification and analysis of mammalian small ubiquitin-like modifier substrates.. J. Biol. Chem. 280: 5004 — 5012.  PubMed DOI:10.1074/jbc.M411718200
  • Zhu B., Ramachandran B., Gulick T. (2005). Alternative pre-mRNA splicing governs expression of a conserved acidic transactivation domain in myocyte enhancer factor 2 factors of striated muscle and brain.. J. Biol. Chem. 280: 28749 — 28760.  PubMed DOI:10.1074/jbc.M502491200

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]