BCL2

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
BCL2
Ідентифікатори
Символи Bcl-2BCL2protein phosphatase 1regulatory subunit 50B-cell CLL/lymphoma 2PPP1R50apoptosis regulator Bcl-2
Зовнішні ІД GeneCards: [1]
Шаблон експресії
PBB GE BCL2 203685 at.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
н/д
н/д
RefSeq (білок)
н/д
н/д
Локус (UCSC) н/д н/д
PubMed search н/д н/д
Вікідані
Див./Ред. для людей

BCL2 (англ. BCL2, apoptosis regulator) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 18-ї хромосоми.[1] Довжина поліпептидного ланцюга білка становить 239 амінокислот, а молекулярна маса — 26 266[2].

Послідовність амінокислот
1020304050
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFS
SQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQA
GDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAF
FEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVE
LYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах, як апоптоз, альтернативний сплайсинг. Локалізований у ядрі, мембрані, мітохондрії, ендоплазматичному ретикулумі, зовнішній мембрані мітохондрій.

Література[ред. | ред. код]

  • Tsujimoto Y., Croce C.M. (1986). Analysis of the structure, transcripts, and protein products of bcl-2, the gene involved in human follicular lymphoma.. Proc. Natl. Acad. Sci. U.S.A. 83: 5214 — 5218.  PubMed DOI:10.1073/pnas.83.14.5214
  • Eguchi Y., Ewert D.L., Tsujimoto Y. (1992). Isolation and characterization of the chicken bcl-2 gene: expression in a variety of tissues including lymphoid and neuronal organs in adult and embryo.. Nucleic Acids Res. 20: 4187 — 4192.  PubMed DOI:10.1093/nar/20.16.4187
  • Cleary M.L., Smith S.D., Sklar J. (1986). Cloning and structural analysis of cDNAs for bcl-2 and a hybrid bcl-2/immunoglobulin transcript resulting from the t(14;18) translocation.. Cell 47: 19 — 28.  PubMed DOI:10.1016/0092-8674(86)90362-4
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Hockenbery D., Nunez G., Milliman C., Schreiber R.D., Korsmeyer S.J. (1990). Bcl-2 is an inner mitochondrial membrane protein that blocks programmed cell death.. Nature 348: 334 — 336.  PubMed DOI:10.1038/348334a0
  • Yin X.-M., Oltvai Z.N., Korsmeyer S.J. (1994). BH1 and BH2 domains of Bcl-2 are required for inhibition of apoptosis and heterodimerization with Bax.. Nature 369: 321 — 323.  PubMed DOI:10.1038/369321a0

Примітки[ред. | ред. код]

  1. HUGO Gene Nomenclature Commitee, HGNC:990 (англ.). Процитовано 12 вересня 2017. 
  2. UniProt, P10415 (англ.). Процитовано 12 вересня 2017. 

Див. також[ред. | ред. код]