TCF7L2

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
TCF7L2
Protein TCF7L2 PDB 1jdh.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи TCF7L2, TCF-4, TCF4, transcription factor 7 like 2
Зовнішні ІД OMIM: 602228 MGI: 1202879 HomoloGene: 7564 GeneCards: TCF7L2
Пов'язані генетичні захворювання
Цукровий діабет 2-го типу, Біполярний афективний розлад, рак молочної залози, Ішемічна хвороба серця, metabolic disease, колоректальний рак[1]
Шаблон експресії
PBB GE TCF7L2 212762 s at fs.png

PBB GE TCF7L2 212759 s at fs.png

PBB GE TCF7L2 212761 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
RefSeq (білок)
Локус (UCSC) Хр. 10: 112.95 – 113.17 Mb Хр. 19: 55.74 – 55.93 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

TCF7L2 (англ. Transcription factor 7 like 2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 10-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 619 амінокислот, а молекулярна маса — 67 919[5].

Послідовність амінокислот
1020304050
MPQLNGGGGDDLGANDELISFKDEGEQEEKSSENSSAERDLADVKSSLVN
ESETNQNSSSDSEAERRPPPRSESFRDKSRESLEEAAKRQDGGLFKGPPY
PGYPFIMIPDLTSPYLPNGSLSPTARTLHFQSGSTHYSAYKTIEHQIAVQ
YLQMKWPLLDVQAGSLQSRQALKDARSPSPAHIVSNKVPVVQHPHHVHPL
TPLITYSNEHFTPGNPPPHLPADVDPKTGIPRPPHPPDISPYYPLSPGTV
GQIPHPLGWLVPQQGQPVYPITTGGFRHPYPTALTVNASMSRFPPHMVPP
HHTLHTTGIPHPAIVTPTVKQESSQSDVGSLHSSKHQDSKKEEEKKKPHI
KKPLNAFMLYMKEMRAKVVAECTLKESAAINQILGRRWHALSREEQAKYY
ELARKERQLHMQLYPGWSARDNYGKKKKRKRDKQPGETNEHSECFLNPCL
SLPPITDLSAPKKCRARFGLDQQNNWCGPCRRKKKCVRYIQGEGSCLSPP
SSDGSLLDSPPPSPNLLGSPPRDAKSQTEQTQPLSLSLKPDPLAHLSMMP
PPPALLLAEATHKASALCPNGALDLPPAALQPAAPSSSIAQPSTSSLHSH
SSLAGTQPQPLSLVTKSLE

Кодований геном білок за функціями належить до репресорів, активаторів, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, сигнальний шлях Wnt, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Barker N., Huls G., Korinek V., Clevers H. (1999). Restricted high level expression of Tcf-4 protein in intestinal and mammary gland epithelium.. Am. J. Pathol. 154: 29 — 35.  PubMed DOI:10.1016/S0002-9440(10)65247-9
  • Omer C.A., Miller P.J., Diehl R.E., Kral A.M. (1999). Identification of Tcf4 residues involved in high-affinity beta-catenin binding.. Biochem. Biophys. Res. Commun. 256: 584 — 590.  PubMed DOI:10.1006/bbrc.1999.0379
  • Brantjes H., Roose J., van De Wetering M., Clevers H. (2001). All Tcf HMG box transcription factors interact with Groucho-related co-repressors.. Nucleic Acids Res. 29: 1410 — 1419.  PubMed DOI:10.1093/nar/29.7.1410
  • Yamamoto H., Ihara M., Matsuura Y., Kikuchi A. (2003). Sumoylation is involved in beta-catenin-dependent activation of Tcf-4.. EMBO J. 22: 2047 — 2059.  PubMed DOI:10.1093/emboj/cdg204
  • Hecht A., Stemmler M.P. (2003). Identification of a promoter-specific transcriptional activation domain at the C-terminus of the Wnt effector protein T-cell factor 4.. J. Biol. Chem. 278: 3776 — 3785.  PubMed DOI:10.1074/jbc.M210081200

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]