IFI35

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
IFI35
Ідентифікатори
Символи IFI35, IFP35, interferon induced protein 35
Зовнішні ІД OMIM: 600735 MGI: 1917360 HomoloGene: 4040 GeneCards: IFI35
Шаблон експресії
PBB GE IFI35 209417 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_005533
NM_001330230
NM_027320
RefSeq (білок)
NP_001317159
NP_005524
NP_081596
Локус (UCSC) Хр. 17: 43.01 – 43.01 Mb Хр. 11: 101.45 – 101.46 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

IFI35 (англ. Interferon induced protein 35) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 17-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 286 амінокислот, а молекулярна маса — 31 546[4].

Послідовність амінокислот
1020304050
MSAPLDAALHALQEEQARLKMRLWDLQQLRKELGDSPKDKVPFSVPKIPL
VFRGHTQQDPEVPKSLVSNLRIHCPLLAGSALITFDDPKVAEQVLQQKEH
TINMEECRLRVQVQPLELPMVTTIQMSSQLSGRRVLVTGFPASLRLSEEE
LLDKLEIFFGKTRNGGGDVDVRELLPGSVMLGFARDGVAQRLCQIGQFTV
PLGGQQVPLRVSPYVNGEIQKAEIRSQPVPRSVLVLNIPDILDGPELHDV
LEIHFQKPTRGGGEVEALTVVPQGQQGLAVFTSESG

Задіяний у такому біологічному процесі, як альтернативний сплайсинг. Локалізований у ядрі.

Література[ред. | ред. код]

  • Wang X., Johansen L.M., Tae H.-J., Taparowsky E.J. (1996). IFP 35 forms complexes with B-ATF, a member of the AP1 family of transcription factors.. Biochem. Biophys. Res. Commun. 229: 316 — 322.  PubMed DOI:10.1006/bbrc.1996.1799
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:5399 (англ.). Процитовано 12 вересня 2017. 
  4. UniProt, P80217 (англ.). Процитовано 12 вересня 2017. 

Див. також[ред. | ред. код]