PAX9

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
PAX9
Ідентифікатори
Символи PAX9, STHAG3, paired box 9
Зовнішні ІД OMIM: 167416 MGI: 97493 HomoloGene: 31360 GeneCards: PAX9
Шаблон експресії
PBB GE PAX9 207059 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_006194
NM_001372076
NM_011041
RefSeq (білок)
NP_006185
NP_001359005
NP_035171
Локус (UCSC) Хр. 14: 36.66 – 36.68 Mb Хр. 12: 56.69 – 56.71 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

PAX9 (англ. Paired box 9) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 14-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 341 амінокислот, а молекулярна маса — 36 310[4].

Послідовність амінокислот
1020304050
MEPAFGEVNQLGGVFVNGRPLPNAIRLRIVELAQLGIRPCDISRQLRVSH
GCVSKILARYNETGSILPGAIGGSKPRVTTPTVVKHIRTYKQRDPGIFAW
EIRDRLLADGVCDKYNVPSVSSISRILRNKIGNLAQQGHYDSYKQHQPTP
QPALPYNHIYSYPSPITAAAAKVPTPPGVPAIPGSVAMPRTWPSSHSVTD
ILGIRSITDQVSDSSPYHSPKVEEWSSLGRNNFPAAAPHAVNGLEKGALE
QEAKYGQAPNGLPAVGSFVSASSMAPYPTPAQVSPYMTYSAAPSGYVAGH
GWQHAGGTSLSPHNCDIPASLAFKGMQAAREGSHSVTASAL

Кодований геном білок за функцією належить до білків розвитку. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Hetzer-Egger C., Schorpp M., Boehm T. (2000). Evolutionary conservation of gene structures of the Pax1/9 gene family.. Biochim. Biophys. Acta 1492: 517 — 521.  PubMed DOI:10.1016/S0167-4781(00)00130-5
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Stapleton P., Weith A., Urbanek P., Kozmik Z., Busslinger M. (1993). Chromosomal localization of seven PAX genes and cloning of a novel family member, PAX-9.. Nat. Genet. 3: 292 — 298.  PubMed DOI:10.1038/ng0493-292
  • Peters H., Schuster G., Neubueser A., Richter T., Hoefler H. (1997). Isolation of the Pax9 cDNA from adult human esophagus.. Mamm. Genome 8: 62 — 64.  PubMed DOI:10.1007/s003359900351
  • Mostowska A., Kobielak A., Biedziak B., Trzeciak W.H. (2003). Novel mutation in the paired box sequence of PAX9 gene in a sporadic form of oligodontia.. Eur. J. Oral Sci. 111: 272 — 276.  PubMed DOI:10.1034/j.1600-0722.2003.00036.x

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:8623 (англ.). Процитовано 11 вересня 2017. 
  4. UniProt, P55771 (англ.). Процитовано 11 вересня 2017. 

Див. також[ред. | ред. код]