NFAT5

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
NFAT5
Ідентифікатори
Символи osmotic response element-binding proteinnuclear factor of activated T-cells 5tonicity-responsiveTonE-binding proteinTonEBPT-cell transcription factor NFAT5glutamine rich protein H65NFAT-like protein 1tonicity-responsive enhancer-binding proteinNFAT5nuclear factor of activated T-cells 5
Зовнішні ІД GeneCards: [1]
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
н/д
н/д
RefSeq (білок)
н/д
н/д
Локус (UCSC) н/д н/д
PubMed search н/д н/д
Вікідані
Див./Ред. для людей

NFAT5 (англ. Nuclear factor of activated T-cells 5) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 16-ї хромосоми.[1] Довжина поліпептидного ланцюга білка становить 1 531 амінокислот, а молекулярна маса — 165 763[2].

Послідовність амінокислот
1020304050
MPSDFISLLSADLDLESPKSLYSRESVYDLLPKELQLPPSRETSVASMSQ
TSGGEAGSPPPAVVAADASSAPSSSSMGGACSSFTTSSSPTIYSTSVTDS
KAMQVESCSSAVGVSNRGVSEKQLTSNTVQQHPSTPKRHTVLYISPPPED
LLDNSRMSCQDEGCGLESEQSCSMWMEDSPSNFSNMSTSSYNDNTEVPRK
SRKRNPKQRPGVKRRDCEESNMDIFDADSAKAPHYVLSQLTTDNKGNSKA
GNGTLENQKGTGVKKSPMLCGQYPVKSEGKELKIVVQPETQHRARYLTEG
SRGSVKDRTQQGFPTVKLEGHNEPVVLQVFVGNDSGRVKPHGFYQACRVT
GRNTTPCKEVDIEGTTVIEVGLDPSNNMTLAVDCVGILKLRNADVEARIG
IAGSKKKSTRARLVFRVNIMRKDGSTLTLQTPSSPILCTQPAGVPEILKK
SLHSCSVKGEEEVFLIGKNFLKGTKVIFQENVSDENSWKSEAEIDMELFH
QNHLIVKVPPYHDQHITLPVSVGIYVVTNAGRSHDVQPFTYTPDPAAAGA
LNVNVKKEISSPARPCSFEEAMKAMKTTGCNLDKVNIIPNALMTPLIPSS
MIKSEDVTPMEVTAEKRSSTIFKTTKSVGSTQQTLENISNIAGNGSFSSP
SSSHLPSENEKQQQIQPKAYNPETLTTIQTQDISQPGTFPAVSASSQLPN
SDALLQQATQFQTRETQSREILQSDGTVVNLSQLTEASQQQQQSPLQEQA
QTLQQQISSNIFPSPNSVSQLQNTIQQLQAGSFTGSTASGSSGSVDLVQQ
VLEAQQQLSSVLFSAPDGNENVQEQLSADIFQQVSQIQSGVSPGMFSSTE
PTVHTRPDNLLPGRAESVHPQSENTLSNQQQQQQQQQQVMESSAAMVMEM
QQSICQAAAQIQSELFPSTASANGNLQQSPVYQQTSHMMSALSTNEDMQM
QCELFSSPPAVSGNETSTTTTQQVATPGTTMFQTSSSGDGEETGTQAKQI
QNSVFQTMVQMQHSGDNQPQVNLFSSTKSMMSVQNSGTQQQGNGLFQQGN
EMMSLQSGNFLQQSSHSQAQLFHPQNPIADAQNLSQETQGSLFHSPNPIV
HSQTSTTSSEQMQPPMFHSQSTIAVLQGSSVPQDQQSTNIFLSQSPMNNL
QTNTVAQEAFFAAPNSISPLQSTSNSEQQAAFQQQAPISHIQTPMLSQEQ
AQPPQQGLFQPQVALGSLPPNPMPQSQQGTMFQSQHSIVAMQSNSPSQEQ
QQQQQQQQQQQQQQQQSILFSNQNTMATMASPKQPPPNMIFNPNQNPMAN
QEQQNQSIFHQQSNMAPMNQEQQPMQFQSQSTVSSLQNPGPTQSESSQTP
LFHSSPQIQLVQGSPSSQEQQVTLFLSPASMSALQTSINQQDMQQSPLYS
PQNNMPGIQGATSSPQPQATLFHNTAGGTMNQLQNSPGSSQQTSGMFLFG
IQNNCSQLLTSGPATLPDQLMAISQPGQPQNEGQPPVTTLLSQQMPENSP
LASSINTNQNIEKIDLLVSLQNQGNNLTGSF

Кодований геном білок за функціями належить до активаторів, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, ацетилювання, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у цитоплазмі, ядрі.

Література[ред. | ред. код]

  • Miyakawa H., Woo S.K., Dahl S.C., Handler J.S., Kwon H.M. (1999). Tonicity-responsive enhancer binding protein, a rel-like protein that stimulates transcription in response to hypertonicity.. Proc. Natl. Acad. Sci. U.S.A. 96: 2538 — 2542.  PubMed DOI:10.1073/pnas.96.5.2538
  • Lopez-Rodriguez C., Aramburu J., Rakeman A.S., Rao A. (1999). NFAT5, a constitutively nuclear NFAT protein that does not cooperate with Fos and Jun.. Proc. Natl. Acad. Sci. U.S.A. 96: 7214 — 7219.  PubMed DOI:10.1073/pnas.96.13.7214
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Zuehlke C., Kiehl R., Johannsmeyer A., Grzeschik K.H., Schwinger E. (1999). Isolation and characterization of novel CAG repeat containing genes expressed in human brain.. DNA Seq. 10: 1 — 6.  PubMed DOI:10.3109/10425179909033929
  • Impens F., Radoshevich L., Cossart P., Ribet D. (2014). Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.. Proc. Natl. Acad. Sci. U.S.A. 111: 12432 — 12437.  PubMed DOI:10.1073/pnas.1413825111
  • Hendriks I.A., Treffers L.W., Verlaan-de Vries M., Olsen J.V., Vertegaal A.C. (2015). SUMO-2 orchestrates chromatin modifiers in response to DNA damage.. Cell Rep. 10: 1778 — 1791.  PubMed DOI:10.1016/j.celrep.2015.02.033

Примітки[ред. | ред. код]

  1. HUGO Gene Nomenclature Commitee, HGNC:7774 (англ.). Процитовано 11 вересня 2017. 
  2. UniProt, O94916 (англ.). Процитовано 11 вересня 2017. 

Див. також[ред. | ред. код]