BCL7C

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
BCL7C
Ідентифікатори
Символи BCL7C, BCL tumor suppressor 7C, BAF complex component, BAF chromatin remodeling complex subunit BCL7C
Зовнішні ІД OMIM: 605847 MGI: 1332237 HomoloGene: 3498 GeneCards: BCL7C
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001286526
NM_004765
NM_009746
NM_001347652
RefSeq (білок)
NP_001273455
NP_004756
NP_001334581
NP_033876
Локус (UCSC) Хр. 16: 30.83 – 30.89 Mb Хр. 7: 127.66 – 127.71 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

BCL7C (англ. BCL tumor suppressor 7C) – білок, який кодується однойменним геном, розташованим у людей на 16-ї хромосомі.[3] Довжина поліпептидного ланцюга білка становить 217 амінокислот, а молекулярна маса — 23 468[4].

Послідовність амінокислот
1020304050
MAGRTVRAETRSRAKDDIKKVMATIEKVRRWEKRWVTVGDTSLRIFKWVP
VVDPQEEERRRAGGGAERSRGRERRGRGASPRGGGPLILLDLNDENSNQS
FHSEGSLQKGTEPSPGGTPQPSRPVSPAGPPEGVPEEAQPPRLGQERDPG
GITAGSTDEPPMLTKEEPVPELLEAEAPEAYPVFEPVPPVPEAAQGDTED
SEGAPPLKRICPNAPDP

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах, як апоптоз, альтернативний сплайсинг.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:1006 (англ.). Процитовано 21 вересня 2017. 
  4. UniProt, Q8WUZ0 (англ.). Процитовано 21 вересня 2017. 

Див. також[ред. | ред. код]