TRPS1

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
TRPS1
Ідентифікатори
Символи TRPS1, GC79, LGCR, transcriptional repressor GATA binding 1
Зовнішні ІД OMIM: 604386 MGI: 1927616 HomoloGene: 8556 GeneCards: TRPS1
Пов'язані генетичні захворювання
Значний депресивний розлад, unipolar depression, trichorhinophalangeal syndrome type II[1]
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001282902
NM_001282903
NM_014112
NM_001330599
NM_032000
NM_001310481
NM_001310485
RefSeq (білок)
NP_001269831
NP_001269832
NP_001317528
NP_054831
н/д
Локус (UCSC) Хр. 8: 115.41 – 115.81 Mb Хр. 15: 50.65 – 50.89 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

TRPS1 (англ. Transcriptional repressor GATA binding 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 8-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 1 281 амінокислот, а молекулярна маса — 141 521[5].

Послідовність амінокислот
1020304050
MVRKKNPPLRNVASEGEGQILEPIGTESKVSGKNKEFSADQMSENTDQSD
AAELNHKEEHSLHVQDPSSSSKKDLKSAVLSEKAGFNYESPSKGGNFPSF
PHDEVTDRNMLAFSSPAAGGVCEPLKSPQRAEADDPQDMACTPSGDSLET
KEDQKMSPKATEETGQAQSGQANCQGLSPVSVASKNPQVPSDGGVRLNKS
KTDLLVNDNPDPAPLSPELQDFKCNICGYGYYGNDPTDLIKHFRKYHLGL
HNRTRQDAELDSKILALHNMVQFSHSKDFQKVNRSVFSGVLQDINSSRPV
LLNGTYDVQVTSGGTFIGIGRKTPDCQGNTKYFRCKFCNFTYMGNSSTEL
EQHFLQTHPNKIKASLPSSEVAKPSEKNSNKSIPALQSSDSGDLGKWQDK
ITVKAGDDTPVGYSVPIKPLDSSRQNGTEATSYYWCKFCSFSCESSSSLK
LLEHYGKQHGAVQSGGLNPELNDKLSRGSVINQNDLAKSSEGETMTKTDK
SSSGAKKKDFSSKGAEDNMVTSYNCQFCDFRYSKSHGPDVIVVGPLLRHY
QQLHNIHKCTIKHCPFCPRGLCSPEKHLGEITYPFACRKSNCSHCALLLL
HLSPGAAGSSRVKHQCHQCSFTTPDVDVLLFHYESVHESQASDVKQEANH
LQGSDGQQSVKESKEHSCTKCDFITQVEEEISRHYRRAHSCYKCRQCSFT
AADTQSLLEHFNTVHCQEQDITTANGEEDGHAISTIKEEPKIDFRVYNLL
TPDSKMGEPVSESVVKREKLEEKDGLKEKVWTESSSDDLRNVTWRGADIL
RGSPSYTQASLGLLTPVSGTQEQTKTLRDSPNVEAAHLARPIYGLAVETK
GFLQGAPAGGEKSGALPQQYPASGENKSKDESQSLLRRRRGSGVFCANCL
TTKTSLWRKNANGGYVCNACGLYQKLHSTPRPLNIIKQNNGEQIIRRRTR
KRLNPEALQAEQLNKQQRGSNEEQVNGSPLERRSEDHLTESHQREIPLPS
LSKYEAQGSLTKSHSAQQPVLVSQTLDIHKRMQPLHIQIKSPQESTGDPG
NSSSVSEGKGSSERGSPIEKYMRPAKHPNYSPPGSPIEKYQYPLFGLPFV
HNDFQSEADWLRFWSKYKLSVPGNPHYLSHVPGLPNPCQNYVPYPTFNLP
PHFSAVGSDNDIPLDLAIKHSRPGPTANGASKEKTKAPPNVKNEGPLNVV
KTEKVDRSTQDELSTKCVHCGIVFLDEVMYALHMSCHGDSGPFQCSICQH
LCTDKYDFTTHIQRGLHRNNAQVEKNGKPKE

Кодований геном білок за функціями належить до репресорів, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном цинку, ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Kaiser F.J., Moeroey T., Chang G.T., Horsthemke B., Luedecke H.J. (2003). The RING finger protein RNF4, a co-regulator of transcription, interacts with the TRPS1 transcription factor.. J. Biol. Chem. 278: 38780 — 38785.  PubMed DOI:10.1074/jbc.M306259200
  • Kaiser F.J., Ludecke H.J., Weger S. (2007). SUMOylation modulates transcriptional repression by TRPS1.. Biol. Chem. 388: 381 — 390.  PubMed DOI:10.1515/BC.2007.051
  • Impens F., Radoshevich L., Cossart P., Ribet D. (2014). Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.. Proc. Natl. Acad. Sci. U.S.A. 111: 12432 — 12437.  PubMed DOI:10.1073/pnas.1413825111
  • Hendriks I.A., Treffers L.W., Verlaan-de Vries M., Olsen J.V., Vertegaal A.C. (2015). SUMO-2 orchestrates chromatin modifiers in response to DNA damage.. Cell Rep. 10: 1778 — 1791.  PubMed DOI:10.1016/j.celrep.2015.02.033

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]