STAT3

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
STAT3
Stat3 structure.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи STAT3, ADMIO, APRF, HIES, signal transducer and activator of transcription 3, ADMIO1
Зовнішні ІД OMIM: 102582 MGI: 103038 HomoloGene: 7960 GeneCards: STAT3
Пов'язані генетичні захворювання
Хвороба Крона, Розсіяний склероз[1]
Шаблон експресії
PBB GE STAT3 208992 s at fs.png

PBB GE STAT3 gnf1h01250 at fs.png

PBB GE STAT3 208991 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_011486
NM_213659
NM_213660
RefSeq (білок)
NP_035616
NP_998824
NP_998825
Локус (UCSC) Хр. 17: 42.31 – 42.39 Mb Хр. 11: 100.89 – 100.94 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

STAT3 (англ. Signal transducer and activator of transcription 3) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 17-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 770 амінокислот, а молекулярна маса — 88 068[5].

Послідовність амінокислот
1020304050
MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKE
SHATLVFHNLLGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPME
IARIVARCLWEESRLLQTAATAAQQGGQANHPTAAVVTEKQQMLEQHLQD
VRKRVQDLEQKMKVVENLQDDFDFNYKTLKSQGDMQDLNGNNQSVTRQKM
QQLEQMLTALDQMRRSIVSELAGLLSAMEYVQKTLTDEELADWKRRQQIA
CIGGPPNICLDRLENWITSLAESQLQTRQQIKKLEELQQKVSYKGDPIVQ
HRPMLEERIVELFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTTKVR
LLVKFPELNYQLKIKVCIDKDSGDVAALRGSRKFNILGTNTKVMNMEESN
NGSLSAEFKHLTLREQRCGNGGRANCDASLIVTEELHLITFETEVYHQGL
KIDLETHSLPVVVISNICQMPNAWASILWYNMLTNNPKNVNFFTKPPIGT
WDQVAEVLSWQFSSTTKRGLSIEQLTTLAEKLLGPGVNYSGCQITWAKFC
KENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILST
KPPGTFLLRFSESSKEGGVTFTWVEKDISGKTQIQSVEPYTKQQLNNMSF
AEIIMGYKIMDATNILVSPLVYLYPDIPKEEAFGKYCRPESQEHPEADPG
SAAPYLKTKFICVTPTTCSNTIDLPMSPRTLDSLMQFGNNGEGAEPSAGG
QFESLTFDMELTSECATSPM

Кодований геном білок за функціями належить до активаторів, фосфопротеїнів. Задіяний у таких біологічних процесах, як взаємодія хазяїн-вірус, транскрипція, регуляція транскрипції, ацетилювання, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у цитоплазмі, ядрі.

Література[ред. | ред. код]

  • Della Pietra L., Bressan A., Pezzotti A., Serlupi-Crescenzi O. (1998). Highly conserved amino-acid sequence between murine STAT3 and a revised human STAT3 sequence.. Gene 213: 119 — 124.  PubMed DOI:10.1016/S0378-1119(98)00185-1
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Zhang X., Blenis J., Li H.-C., Schindler C., Chen-Kiang S. (1995). Requirement of serine phosphorylation for formation of STAT-promoter complexes.. Science 267: 1990 — 1994.  PubMed DOI:10.1126/science.7701321
  • Wierenga A.T., Vogelzang I., Eggen B.J., Vellenga E. (2003). Erythropoietin-induced serine 727 phosphorylation of STAT3 in erythroid cells is mediated by a MEK-, ERK-, and MSK1-dependent pathway.. Exp. Hematol. 31: 398 — 405.  PubMed DOI:10.1016/S0301-472X(03)00045-6
  • Ronnstrand L. (2004). Signal transduction via the stem cell factor receptor/c-Kit.. Cell. Mol. Life Sci. 61: 2535 — 2548.  PubMed DOI:10.1007/s00018-004-4189-6
  • Huang Y., Li T., Sane D.C., Li L. (2004). IRAK1 serves as a novel regulator essential for lipopolysaccharide-induced interleukin-10 gene expression.. J. Biol. Chem. 279: 51697 — 51703.  PubMed DOI:10.1074/jbc.M410369200

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]