ZNF202

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
ZNF202
Ідентифікатори
Символи ZNF202, ZKSCAN10, ZSCAN42, zinc finger protein 202
Зовнішні ІД OMIM: 603430 MGI: 1933401 HomoloGene: 68317 GeneCards: ZNF202
Шаблон експресії
PBB GE ZNF202 204327 s at fs.png

PBB GE ZNF202 204329 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001301779
NM_001301780
NM_001301819
NM_003455
NM_030713
NM_001359464
RefSeq (білок)
NP_001288708
NP_001288709
NP_001288748
NP_003446
н/д
Локус (UCSC) Хр. 11: 123.72 – 123.74 Mb Хр. 9: 40.19 – 40.21 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

ZNF202 (англ. Zinc finger protein 202) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 11-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 648 амінокислот, а молекулярна маса — 74 720[4].

Послідовність амінокислот
1020304050
MATAVEPEDQDLWEEEGILMVKLEDDFTCRPESVLQRDDPVLETSHQNFR
RFRYQEAASPREALIRLRELCHQWLRPERRTKEQILELLVLEQFLTVLPG
ELQSWVRGQRPESGEEAVTLVEGLQKQPRRPRRWVTVHVHGQEVLSEETV
HLGVEPESPNELQDPVQSSTPEQSPEETTQSPDLGAPAEQRPHQEEELQT
LQESEVPVPEDPDLPAERSSGDSEMVALLTALSQGLVTFKDVAVCFSQDQ
WSDLDPTQKEFYGEYVLEEDCGIVVSLSFPIPRPDEISQVREEEPWVPDI
QEPQETQEPEILSFTYTGDRSKDEEECLEQEDLSLEDIHRPVLGEPEIHQ
TPDWEIVFEDNPGRLNERRFGTNISQVNSFVNLRETTPVHPLLGRHHDCS
VCGKSFTCNSHLVRHLRTHTGEKPYKCMECGKSYTRSSHLARHQKVHKMN
APYKYPLNRKNLEETSPVTQAERTPSVEKPYRCDDCGKHFRWTSDLVRHQ
RTHTGEKPFFCTICGKSFSQKSVLTTHQRIHLGGKPYLCGECGEDFSEHR
RYLAHRKTHAAEELYLCSECGRCFTHSAAFAKHLRGHASVRPCRCNECGK
SFSRRDHLVRHQRTHTGEKPFTCPTCGKSFSRGYHLIRHQRTHSEKTS

Кодований геном білок за функціями належить до репресорів, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном цинку, ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:12994 (англ.). Процитовано 8 вересня 2017. 
  4. UniProt, O95125 (англ.). Процитовано 8 вересня 2017. 

Див. також[ред. | ред. код]