TAF9B

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
TAF9B
Ідентифікатори
Символи TAF9B, DN-7, DN7, TAF9L, TAFII31L, TFIID-31, TATA-box binding protein associated factor 9b
Зовнішні ІД OMIM: 300754 MGI: 3039562 HomoloGene: 47969 GeneCards: TAF9B
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_015975
NM_001001176
NM_001167988
RefSeq (білок)
NP_057059
NP_001001176
NP_001161460
Локус (UCSC) Хр. X: 78.13 – 78.14 Mb Хр. X: 106.21 – 106.22 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

TAF9B (англ. TATA-box binding protein associated factor 9b) – білок, який кодується однойменним геном, розташованим у людей на X-хромосомі.[3] Довжина поліпептидного ланцюга білка становить 251 амінокислот, а молекулярна маса — 27 622[4].

Послідовність амінокислот
1020304050
MESGKMAPPKNAPRDALVMAQILKDMGITEYEPRVINQMLEFAFRYVTTI
LDDAKIYSSHAKKPNVDADDVRLAIQCRADQSFTSPPPRDFLLDIARQKN
QTPLPLIKPYAGPRLPPDRYCLTAPNYRLKSLIKKGPNQGRLVPRLSVGA
VSSKPTTPTIATPQTVSVPNKVATPMSVTSQRFTVQIPPSQSTPVKPVPA
TTAVQNVLINPSMIGPKNILITTNMVSSQNTANEANPLKRKHEDDDDNDI
M

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, ацетилювання. Локалізований у ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:17306 (англ.). Процитовано 13 вересня 2017. 
  4. UniProt, Q9HBM6 (англ.). Процитовано 13 вересня 2017. 

Див. також[ред. | ред. код]