ELK1

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
ELK1
Protein ELK1 PDB 1dux.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи ELK1, ETS transcription factor, ETS transcription factor ELK1
Зовнішні ІД OMIM: 311040 MGI: 101833 HomoloGene: 3832 GeneCards: ELK1
Шаблон експресії
PBB GE ELK1 210376 x at fs.png

PBB GE ELK1 203617 x at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_005229
NM_001114123
NM_001257168
NM_007922
RefSeq (білок)
NP_001107595
NP_001244097
NP_005220
NP_031948
Локус (UCSC) Хр. X: 47.64 – 47.65 Mb Хр. X: 20.93 – 20.95 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

ELK1 (англ. ELK1, ETS transcription factor) – білок, який кодується однойменним геном, розташованим у людей на X-хромосомі.[3] Довжина поліпептидного ланцюга білка становить 428 амінокислот, а молекулярна маса — 44 888[4].

Послідовність амінокислот
1020304050
MDPSVTLWQFLLQLLREQGNGHIISWTSRDGGEFKLVDAEEVARLWGLRK
NKTNMNYDKLSRALRYYYDKNIIRKVSGQKFVYKFVSYPEVAGCSTEDCP
PQPEVSVTSTMPNVAPAAIHAAPGDTVSGKPGTPKGAGMAGPGGLARSSR
NEYMRSGLYSTFTIQSLQPQPPPHPRPAVVLPSAAPAGAAAPPSGSRSTS
PSPLEACLEAEEAGLPLQVILTPPEAPNLKSEELNVEPGLGRALPPEVKV
EGPKEELEVAGERGFVPETTKAEPEVPPQEGVPARLPAVVMDTAGQAGGH
AASSPEISQPQKGRKPRDLELPLSPSLLGGPGPERTPGSGSGSGLQAPGP
ALTPSLLPTHTLTPVLLTPSSLPPSIHFWSTLSPIAPRSPAKLSFQFPSS
GSAQVHIPSISVDGLSTPVVLSPGPQKP

Кодований геном білок за функціями належить до активаторів, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Harindranath N., Mills F.C., Mitchell M.P., Meindl A., Max E.E. (1998). The human elk-1 gene family: the functional gene and two processed pseudogenes embedded in the IgH locus.. Gene 221: 215 — 224.  PubMed DOI:10.1016/S0378-1119(98)00448-X
  • Yamauchi T., Toko M., Suga M., Hatakeyama T., Isobe M. (1999). Structural organization of the human ELK1 gene and its processed pseudogene ELK2 genes.. DNA Res. 6: 21 — 27.  PubMed DOI:10.1093/dnares/6.1.21
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Janknecht R., Nordheim A. (1992). Elk-1 protein domains required for direct and SRF-assisted DNA-binding.. Nucleic Acids Res. 20: 3317 — 3324.  PubMed DOI:10.1093/nar/20.13.3317
  • Enslen H., Tokumitsu H., Stork P.J., Davis R.J., Soderling T.R. (1996). Regulation of mitogen-activated protein kinases by a calcium/calmodulin-dependent protein kinase cascade.. Proc. Natl. Acad. Sci. U.S.A. 93: 10803 — 10808.  PubMed DOI:10.1073/pnas.93.20.10803
  • Enslen H., Raingeaud J., Davis R.J. (1998). Selective activation of p38 mitogen-activated protein (MAP) kinase isoforms by the MAP kinase kinases MKK3 and MKK6.. J. Biol. Chem. 273: 1741 — 1748.  PubMed DOI:10.1074/jbc.273.3.1741

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:3321 (англ.). Процитовано 12 вересня 2017. 
  4. UniProt, P19419 (англ.). Процитовано 12 вересня 2017. 

Див. також[ред. | ред. код]