HEY2

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
HEY2
Ідентифікатори
Символи HEY2, CHF1, GRIDLOCK, GRL, HERP1, HESR2, HRT2, bHLHb32, hes related family bHLH transcription factor with YRPW motif 2
Зовнішні ІД OMIM: 604674 MGI: 1341884 HomoloGene: 22705 GeneCards: HEY2
Шаблон експресії
PBB GE HEY2 219743 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_012259
NM_013904
RefSeq (білок)
NP_036391
NP_038932
Локус (UCSC) Хр. 6: 125.75 – 125.76 Mb Хр. 10: 30.83 – 30.84 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

HEY2 (англ. Hes related family bHLH transcription factor with YRPW motif 2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 6-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 337 амінокислот, а молекулярна маса — 35 808[4].

Послідовність амінокислот
1020304050
MKRPCEETTSESDMDETIDVGSENNYSGQSTSSVIRLNSPTTTSQIMARK
KRRGIIEKRRRDRINNSLSELRRLVPTAFEKQGSAKLEKAEILQMTVDHL
KMLQATGGKGYFDAHALAMDFMSIGFRECLTEVARYLSSVEGLDSSDPLR
VRLVSHLSTCATQREAAAMTSSMAHHHHPLHPHHWAAAFHHLPAALLQPN
GLHASESTPCRLSTTSEVPPAHGSALLTATFAHADSALRMPSTGSVAPCV
PPLSTSLLSLSATVHAAAAAATAAAHSFPLSFAGAFPMLPPNAAAAVAAA
TAISPPLSVSATSSPQQTSSGTNNKPYRPWGTEVGAF

Кодований геном білок за функціями належить до репресорів, білків розвитку. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Leimeister C., Externbrinck A., Klamt B., Gessler M. (1999). Hey genes: a novel subfamily of hairy- and enhancer of split related genes specifically expressed during mouse embryogenesis.. Mech. Dev. 85: 173 — 177.  PubMed DOI:10.1016/S0925-4773(99)00080-5
  • Zhong T.P., Rosenberg M., Mohideen M.-A.P.K., Weinstein B., Fishman M.C. (2000). Gridlock, an HLH gene required for assembly of the aorta in zebrafish.. Science 287: 1820 — 1824.  PubMed DOI:10.1126/science.287.5459.1820
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Shirvani S., Xiang F., Koibuchi N., Chin M.T. (2006). CHF1/Hey2 suppresses SM-MHC promoter activity through an interaction with GATA-6.. Biochem. Biophys. Res. Commun. 339: 151 — 156.  PubMed DOI:10.1016/j.bbrc.2005.10.190
  • Reamon-Buettner S.M., Borlak J. (2006). HEY2 mutations in malformed hearts.. Hum. Mutat. 27: 118 — 118.  PubMed DOI:10.1002/humu.9390

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:4881 (англ.). Процитовано 6 вересня 2017. 
  4. UniProt, Q9UBP5 (англ.). Процитовано 6 вересня 2017. 

Див. також[ред. | ред. код]