TFAP2B

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
TFAP2B
Ідентифікатори
Символи TFAP2B, AP-2B, AP2-B, transcription factor AP-2 beta, PDA2
Зовнішні ІД OMIM: 601601 MGI: 104672 HomoloGene: 20688 GeneCards: TFAP2B
Пов'язані генетичні захворювання
Ожиріння, metabolic disease, Char syndrome, patent ductus arteriosus 2[1]
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_003221
NM_001025305
NM_001286340
NM_009334
RefSeq (білок)
NP_003212
NP_001020476
NP_001273269
NP_033360
Локус (UCSC) Хр. 6: 50.82 – 50.85 Mb Хр. 1: 19.21 – 19.24 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

TFAP2B (англ. Transcription factor AP-2 beta) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 6-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 460 амінокислот, а молекулярна маса — 50 474[5].

Послідовність амінокислот
1020304050
MHSPPRDQAAIMLWKLVENVKYEDIYEDRHDGVPSHSSRLSQLGSVSQGP
YSSAPPLSHTPSSDFQPPYFPPPYQPLPYHQSQDPYSHVNDPYSLNPLHQ
PQQHPWGQRQRQEVGSEAGSLLPQPRAALPQLSGLDPRRDYHSVRRPDVL
LHSAHHGLDAGMGDSLSLHGLGHPGMEDVQSVEDANNSGMNLLDQSVIKK
VPVPPKSVTSLMMNKDGFLGGMSVNTGEVFCSVPGRLSLLSSTSKYKVTV
GEVQRRLSPPECLNASLLGGVLRRAKSKNGGRSLRERLEKIGLNLPAGRR
KAANVTLLTSLVEGEAVHLARDFGYICETEFPAKAVSEYLNRQHTDPSDL
HSRKNMLLATKQLCKEFTDLLAQDRTPIGNSRPSPILEPGIQSCLTHFSL
ITHGFGAPAICAALTALQNYLTEALKGMDKMFLNNTTTNRHTSGEGPGSK
TGDKEEKHRK

Кодований геном білок за функціями належить до активаторів, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Moser M., Buettner R. (1997). Enhanced apoptotic cell death of renal epithelial cells in mice lacking transcription factor AP-2beta.. Genes Dev. 11: 1938 — 1948.  PubMed DOI:10.1101/gad.11.15.1938
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Eloranta J.J., Hurst H.C. (2002). Transcription factor AP-2 interacts with the SUMO-conjugating enzyme UBC9 and is sumolated in vivo.. J. Biol. Chem. 277: 30798 — 30804.  PubMed DOI:10.1074/jbc.M202780200
  • Khetyar M., Syrris P., Tinworth L., Abushaban L., Carter N. (2008). Novel TFAP2B mutation in nonsyndromic patent ductus arteriosus.. Genet. Test. 12: 457 — 459.  PubMed DOI:10.1089/gte.2008.0015

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]