MLX

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
MLX
Ідентифікатори
Символи MLX, MAD7, MXD7, TCFL4, bHLHd13, MAX dimerization protein, TF4, MAX dimerization protein MLX
Зовнішні ІД OMIM: 602976 MGI: 108398 HomoloGene: 7969 GeneCards: MLX
Шаблон експресії
PBB GE MLX 213708 s at fs.png

PBB GE MLX 217909 s at fs.png

PBB GE MLX 210752 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_198205
NM_170607
NM_198204
NM_001159384
NM_001159385
NM_011550
RefSeq (білок)
NP_733752
NP_937847
NP_937848
NP_001152856
NP_001152857
NP_035680
Локус (UCSC) Хр. 17: 42.57 – 42.57 Mb Хр. 11: 101.09 – 101.09 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

MLX (англ. MLX, MAX dimerization protein) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 17-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 298 амінокислот, а молекулярна маса — 33 300[4].

Послідовність амінокислот
1020304050
MTEPGASPEDPWVKASPVGAHAGEGRAGRARARRGAGRRGASLLSPKSPT
LSVPRGCREDSSHPACAKVEYAYSDNSLDPGLFVESTRKGSVVSRANSIG
STSASSVPNTDDEDSDYHQEAYKESYKDRRRRAHTQAEQKRRDAIKRGYD
DLQTIVPTCQQQDFSIGSQKLSKAIVLQKTIDYIQFLHKEKKKQEEEVST
LRKDVTALKIMKVNYEQIVKAHQDNPHEGEDQVSDQVKFNVFQGIMDSLF
QSFNASISVASFQELSACVFSWIEEHCKPQTLREIVIGVLHQLKNQLY

Кодований геном білок за функціями належить до репресорів, активаторів, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у цитоплазмі, ядрі.

Література[ред. | ред. код]

  • Billin A.N., Eilers A.L., Queva C., Ayer D.E. (1999). Mlx, a novel Max-like bHLHZip protein that interacts with the Max network of transcription factors.. J. Biol. Chem. 274: 36344 — 36350.  PubMed DOI:10.1074/jbc.274.51.36344
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Eilers A.L., Sundwall E., Lin M., Sullivan A.A., Ayer D.E. (2002). A novel heterodimerization domain, CRM1, and 14-3-3 control subcellular localization of the MondoA-Mlx heterocomplex.. Mol. Cell. Biol. 22: 8514 — 8526.  PubMed DOI:10.1128/MCB.22.24.8514-8526.2002
  • Sans C.L., Satterwhite D.J., Stoltzman C.A., Breen K.T., Ayer D.E. (2006). MondoA-Mlx heterodimers are candidate sensors of cellular energy status: mitochondrial localization and direct regulation of glycolysis.. Mol. Cell. Biol. 26: 4863 — 4871.  PubMed DOI:10.1128/MCB.00657-05

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:11645 (англ.). Процитовано 12 вересня 2017. 
  4. UniProt, Q9UH92 (англ.). Процитовано 12 вересня 2017. 

Див. також[ред. | ред. код]