ZEB1

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
ZEB1
Protein ZEB1 PDB 2e19.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи ZEB1, zinc finger E-box binding homeobox 1, AREB6, BZP, DELTAEF1, FECD6, NIL2A, PPCD3, TCF8, ZFHEP, ZFHX1A
Зовнішні ІД MGI: 1344313 HomoloGene: 31779 GeneCards: ZEB1
Шаблон експресії
PBB GE ZEB1 210875 s at fs.png

PBB GE ZEB1 212758 s at fs.png

PBB GE ZEB1 212764 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_011546
NM_001360981
NM_001360982
RefSeq (білок)
NP_035676
NP_001347910
NP_001347911
Локус (UCSC) Хр. 10: 31.32 – 31.53 Mb Хр. 18: 5.59 – 5.78 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

ZEB1 (англ. Zinc finger E-box binding homeobox 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 10-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 1 124 амінокислот, а молекулярна маса — 124 074[4].

Послідовність амінокислот
1020304050
MADGPRCKRRKQANPRRNNVTNYNTVVETNSDSDDEDKLHIVEEESVTDA
ADCEGVPEDDLPTDQTVLPGRSSEREGNAKNCWEDDRKEGQEILGPEAQA
DEAGCTVKDDECESDAENEQNHDPNVEEFLQQQDTAVIFPEAPEEDQRQG
TPEASGHDENGTPDAFSQLLTCPYCDRGYKRFTSLKEHIKYRHEKNEDNF
SCSLCSYTFAYRTQLERHMTSHKSGRDQRHVTQSGCNRKFKCTECGKAFK
YKHHLKEHLRIHSGEKPYECPNCKKRFSHSGSYSSHISSKKCISLIPVNG
RPRTGLKTSQCSSPSLSASPGSPTRPQIRQKIENKPLQEQLSVNQIKTEP
VDYEFKPIVVASGINCSTPLQNGVFTGGGPLQATSSPQGMVQAVVLPTVG
LVSPISINLSDIQNVLKVAVDGNVIRQVLENNQANLASKEQETINASPIQ
QGGHSVISAISLPLVDQDGTTKIIINYSLEQPSQLQVVPQNLKKENPVAT
NSCKSEKLPEDLTVKSEKDKSFEGGVNDSTCLLCDDCPGDINALPELKHY
DLKQPTQPPPLPAAEAEKPESSVSSATGDGNLSPSQPPLKNLLSLLKAYY
ALNAQPSAEELSKIADSVNLPLDVVKKWFEKMQAGQISVQSSEPSSPEPG
KVNIPAKNNDQPQSANANEPQDSTVNLQSPLKMTNSPVLPVGSTTNGSRS
STPSPSPLNLSSSRNTQGYLYTAEGAQEEPQVEPLDLSLPKQQGELLERS
TITSVYQNSVYSVQEEPLNLSCAKKEPQKDSCVTDSEPVVNVIPPSANPI
NIAIPTVTAQLPTIVAIADQNSVPCLRALAANKQTILIPQVAYTYSTTVS
PAVQEPPLKVIQPNGNQDERQDTSSEGVSNVEDQNDSDSTPPKKKMRKTE
NGMYACDLCDKIFQKSSSLLRHKYEHTGKRPHECGICKKAFKHKHHLIEH
MRLHSGEKPYQCDKCGKRFSHSGSYSQHMNHRYSYCKREAEERDSTEQEE
AGPEILSNEHVGARASPSQGDSDERESLTREEDEDSEKEEEEEDKEMEEL
QEEKECEKPQGDEEEEEEEEEVEEEEVEEAENEGEEAKTEGLMKDDRAES
QASSLGQKVGESSEQVSEEKTNEA

Кодований геном білок за функціями належить до репресорів, активаторів, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, диференціація клітин, нейрогенез, альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном цинку, ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Long J., Zuo D., Park M. (2005). Pc2-mediated sumoylation of Smad-interacting protein 1 attenuates transcriptional repression of E-cadherin.. J. Biol. Chem. 280: 35477 — 35489.  PubMed DOI:10.1074/jbc.M504477200
  • Papadopoulou V., Postigo A., Sanchez-Tillo E., Porter A.C., Wagner S.D. (2010). ZEB1 and CtBP form a repressive complex at a distal promoter element of the BCL6 locus.. Biochem. J. 427: 541 — 550.  PubMed DOI:10.1042/BJ20091578
  • Impens F., Radoshevich L., Cossart P., Ribet D. (2014). Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.. Proc. Natl. Acad. Sci. U.S.A. 111: 12432 — 12437.  PubMed DOI:10.1073/pnas.1413825111
  • Hendriks I.A., Treffers L.W., Verlaan-de Vries M., Olsen J.V., Vertegaal A.C. (2015). SUMO-2 orchestrates chromatin modifiers in response to DNA damage.. Cell Rep. 10: 1778 — 1791.  PubMed DOI:10.1016/j.celrep.2015.02.033
  • Chung D.W., Frausto R.F., Ann L.B., Jang M.S., Aldave A.J. (2014). Functional impact of ZEB1 mutations associated with posterior polymorphous and Fuchs' endothelial corneal dystrophies.. Invest. Ophthalmol. Vis. Sci. 55: 6159 — 6166.  PubMed DOI:10.1167/iovs.14-15247

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:11642 (англ.). Процитовано 8 вересня 2017. 
  4. UniProt, P37275 (англ.). Процитовано 8 вересня 2017. 

Див. також[ред. | ред. код]