RXRA

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
RXRA
Protein RXRA PDB 1by4.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи RXRA, NR2B1, Retinoid X receptor alpha
Зовнішні ІД OMIM: 180245 MGI: 98214 HomoloGene: 2220 GeneCards: RXRA
Реагує на сполуку
alitretinoin, bexarotene[1]
Шаблон експресії
PBB GE RXRA 202449 s at fs.png

PBB GE RXRA 202426 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_002957
NM_001291920
NM_001291921
NM_001290481
NM_001290482
NM_011305
RefSeq (білок)
NP_001278849
NP_001278850
NP_002948
NP_001277410
NP_001277411
NP_035435
Локус (UCSC) Хр. 9: 134.32 – 134.44 Mb Хр. 2: 27.68 – 27.76 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

RXRA (англ. Retinoid X receptor alpha) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 9-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 462 амінокислот, а молекулярна маса — 50 811[5].

Послідовність амінокислот
1020304050
MDTKHFLPLDFSTQVNSSLTSPTGRGSMAAPSLHPSLGPGIGSPGQLHSP
ISTLSSPINGMGPPFSVISSPMGPHSMSVPTTPTLGFSTGSPQLSSPMNP
VSSSEDIKPPLGLNGVLKVPAHPSGNMASFTKHICAICGDRSSGKHYGVY
SCEGCKGFFKRTVRKDLTYTCRDNKDCLIDKRQRNRCQYCRYQKCLAMGM
KREAVQEERQRGKDRNENEVESTSSANEDMPVERILEAELAVEPKTETYV
EANMGLNPSSPNDPVTNICQAADKQLFTLVEWAKRIPHFSELPLDDQVIL
LRAGWNELLIASFSHRSIAVKDGILLATGLHVHRNSAHSAGVGAIFDRVL
TELVSKMRDMQMDKTELGCLRAIVLFNPDSKGLSNPAEVEALREKVYASL
EAYCKHKYPEQPGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDTF
LMEMLEAPHQMT

Кодований геном білок за функціями належить до рецепторів, фосфопротеїнів. Задіяний у таких біологічних процесах, як взаємодія хазяїн-вірус, транскрипція, регуляція транскрипції, альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном цинку, ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Mangelsdorf D.J., Ong E.S., Dyck J.A., Evans R.M. (1990). Nuclear receptor that identifies a novel retinoic acid response pathway.. Nature 345: 224 — 229.  PubMed DOI:10.1038/345224a0
  • Kobayashi T., Kodani Y., Nozawa A., Endo Y., Sawasaki T. (2008). DNA-binding profiling of human hormone nuclear receptors via fluorescence correlation spectroscopy in a cell-free system.. FEBS Lett. 582: 2737 — 2744.  PubMed DOI:10.1016/j.febslet.2008.07.003
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Gorla-Bajszczak A., Juge-Aubry C., Pernin A., Burger A.G., Meier C.A. (1999). Conserved amino acids in the ligand-binding and tau(i) domains of the peroxisome proliferator-activated receptor alpha are necessary for heterodimerization with RXR.. Mol. Cell. Endocrinol. 147: 37 — 47.  PubMed DOI:10.1016/S0303-7207(98)00217-2
  • Harish S., Ashok M.S., Khanam T., Rangarajan P.N. (2000). Serine 27, a human retinoid X receptor alpha residue, phosphorylated by protein kinase A is essential for cyclicAMP-mediated downregulation of RXRalpha function.. Biochem. Biophys. Res. Commun. 279: 853 — 857.  PubMed DOI:10.1006/bbrc.2000.4043
  • Mathur M., Tucker P.W., Samuels H.H. (2001). PSF is a novel corepressor that mediates its effect through Sin3A and the DNA binding domain of nuclear hormone receptors.. Mol. Cell. Biol. 21: 2298 — 2311.  PubMed DOI:10.1128/MCB.21.7.2298-2311.2001

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]