FHL1

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
FHL1
Ідентифікатори
Символи FHL1SLIM-1skeletal muscle LIM-protein 1SLIMLIM protein SLIMMERfour and a half LIM domains protein 1four-and-a-half Lin11Isl-1 and Mec-3 domains 1
Зовнішні ІД GeneCards: [1]
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
н/д
н/д
RefSeq (білок)
н/д
н/д
Локус (UCSC) н/д н/д
PubMed search н/д н/д
Вікідані
Див./Ред. для людей

FHL1 (англ. Four and a half LIM domains 1) – білок, який кодується однойменним геном, розташованим у людей на X-хромосомі.[1] Довжина поліпептидного ланцюга білка становить 323 амінокислот, а молекулярна маса — 36 263[2].

Послідовність амінокислот
1020304050
MAEKFDCHYCRDPLQGKKYVQKDGHHCCLKCFDKFCANTCVECRKPIGAD
SKEVHYKNRFWHDTCFRCAKCLHPLANETFVAKDNKILCNKCTTREDSPK
CKGCFKAIVAGDQNVEYKGTVWHKDCFTCSNCKQVIGTGSFFPKGEDFYC
VTCHETKFAKHCVKCNKAITSGGITYQDQPWHADCFVCVTCSKKLAGQRF
TAVEDQYYCVDCYKNFVAKKCAGCKNPITGKRTVSRVSHPVSKARKPPVC
HGKRLPLTLFPSANLRGRHPGGERTCPSWVVVLYRKNRSLAAPRGPGLVK
APVWWPMKDNPGTTTASTAKNAP

Кодований геном білок за функцією належить до білків розвитку. Задіяний у таких біологічних процесах, як диференціація клітин, ацетилювання, альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном цинку. Локалізований у цитоплазмі, ядрі.

Література[ред. | ред. код]

  • Morgan M.J., Madgwick A.J.A. (1996). Slim defines a novel family of LIM-proteins expressed in skeletal muscle.. Biochem. Biophys. Res. Commun. 225: 632 — 638.  PubMed DOI:10.1006/bbrc.1996.1222
  • Greene W.K., Baker E., Rabbitts T.H., Kees U.R. (1999). Genomic structure, tissue expression and chromosomal location of the LIM-only gene, SLIM1.. Gene 232: 203 — 207.  PubMed DOI:10.1016/S0378-1119(99)00125-0
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Morgan M.J., Madgwick A.J.A., Charleston B., Pell J.M., Loughna P.T. (1995). The developmental regulation of a novel muscle LIM-protein.. Biochem. Biophys. Res. Commun. 212: 840 — 846.  PubMed DOI:10.1006/bbrc.1995.2045
  • Shalaby S., Hayashi Y.K., Nonaka I., Noguchi S., Nishino I. (2009). Novel FHL1 mutations in fatal and benign reducing body myopathy.. Neurology 72: 375 — 376.  PubMed DOI:10.1212/01.wnl.0000341311.84347.a0

Примітки[ред. | ред. код]

  1. HUGO Gene Nomenclature Commitee, HGNC:3702 (англ.). Процитовано 12 вересня 2017. 
  2. UniProt, Q13642 (англ.). Процитовано 12 вересня 2017. 

Див. також[ред. | ред. код]