RARB

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
RARB
Protein RARB PDB 1dsz.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи RARB, HAP, MCOPS12, NR1B2, RRB2, RARbeta1, retinoic acid receptor beta
Зовнішні ІД OMIM: 180220 MGI: 97857 HomoloGene: 68100 GeneCards: RARB
Пов'язані генетичні захворювання
morbid obesity[1]
Реагує на сполуку
adapalene, alitretinoin, tamibarotene, tazarotene, Третиноїн[2]
Шаблон експресії
PBB GE RARB 205080 at fs.png

PBB GE RARB 208412 s at fs.png

PBB GE RARB 208530 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001289760
NM_001289761
NM_001289762
NM_011243
RefSeq (білок)
NP_001276689
NP_001276690
NP_001276691
NP_035373
Локус (UCSC) Хр. 3: 25.17 – 25.6 Mb Хр. 14: 16.43 – 16.82 Mb
PubMed search [3] [4]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

RARB (англ. Retinoic acid receptor beta) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 3-ї хромосоми. [5] Довжина поліпептидного ланцюга білка становить 455 амінокислот, а молекулярна маса — 50 489[6].

Послідовність амінокислот
1020304050
MTTSGHACPVPAVNGHMTHYPATPYPLLFPPVIGGLSLPPLHGLHGHPPP
SGCSTPSPATIETQSTSSEELVPSPPSPLPPPRVYKPCFVCQDKSSGYHY
GVSACEGCKGFFRRSIQKNMIYTCHRDKNCVINKVTRNRCQYCRLQKCFE
VGMSKESVRNDRNKKKKETSKQECTESYEMTAELDDLTEKIRKAHQETFP
SLCQLGKYTTNSSADHRVRLDLGLWDKFSELATKCIIKIVEFAKRLPGFT
GLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNA
GFGPLTDLVFTFANQLLPLEMDDTETGLLSAICLICGDRQDLEEPTKVDK
LQEPLLEALKIYIRKRRPSKPHMFPKILMKITDLRSISAKGAERVITLKM
EIPGSMPPLIQEMLENSEGHEPLTPSSSGNTAEHSPSISPSSVENSGVSQ
SPLVQ

Кодований геном білок за функціями належить до рецепторів, фосфопротеїнів. Задіяний у таких біологічних процесах як транскрипція, регуляція транскрипції, поліморфізм, альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном цинку, ДНК. Локалізований у цитоплазмі, ядрі.

Література[ред. | ред. код]

  • Benbrook D., Lernherdt E., Pfahl M. (1988). A new retinoic acid receptor identified from a hepatocellular carcinoma.. Nature 333: 669 — 672.  PubMed DOI:10.1038/333669a0
  • de The H., Marchio A., Tiollais P., Dejean A. (1987). A novel steroid thyroid hormone receptor-related gene inappropriately expressed in human hepatocellular carcinoma.. Nature 330: 667 — 670.  PubMed DOI:10.1038/330667a0
  • Sommer K.M., Chen L.I., Treuting P.M., Smith L.T., Swisshelm K. (1999). Elevated retinoic acid receptor beta(4) protein in human breast tumor cells with nuclear and cytoplasmic localization.. Proc. Natl. Acad. Sci. U.S.A. 96: 8651 — 8656.  PubMed DOI:10.1073/pnas.96.15.8651
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Shen S., Kruyt F.A., den Hertog J., van der Saag P.T., Kruijer W. (1991). Mouse and human retinoic acid receptor beta 2 promoters: sequence comparison and localization of retinoic acid responsiveness.. DNA Seq. 2: 111 — 119.  PubMed DOI:10.3109/10425179109039679
  • Dejean A., Bougueleret L., Grzeschik K.-H., Tiollais P. (1986). Hepatitis B virus DNA integration in a sequence homologous to v-erb-A and steroid receptor genes in a hepatocellular carcinoma.. Nature 322: 70 — 72.  PubMed DOI:10.1038/322070a0

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]