KDM5D

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
KDM5D
Protein KDM5D PDB 2E6R.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи KDM5D, HY, HYA, JARID1D, SMCY, lysine demethylase 5D
Зовнішні ІД OMIM: 426000 MGI: 99780 HomoloGene: 55838 GeneCards: KDM5D
Шаблон експресії
PBB GE JARID1D 206700 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001146705
NM_001146706
NM_004653
NM_011419
RefSeq (білок)
NP_001140177
NP_001140178
NP_004644
NP_035549
Локус (UCSC) Хр. Y: 19.7 – 19.74 Mb Хр. Y: 0.9 – 0.96 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

KDM5D (англ. Lysine demethylase 5D) – білок, який кодується однойменним геном, розташованим у людей на Y-хромосомі.[3] Довжина поліпептидного ланцюга білка становить 1 539 амінокислот, а молекулярна маса — 174 073[4].

Послідовність амінокислот
1020304050
MEPGCDEFLPPPECPVFEPSWAEFQDPLGYIAKIRPIAEKSGICKIRPPA
DWQPPFAVEVDNFRFTPRVQRLNELEAQTRVKLNYLDQIAKFWEIQGSSL
KIPNVERKILDLYSLSKIVIEEGGYEAICKDRRWARVAQRLHYPPGKNIG
SLLRSHYERIIYPYEMFQSGANHVQCNTHPFDNEVKDKEYKPHSIPLRQS
VQPSKFSSYSRRAKRLQPDPEPTEEDIEKHPELKKLQIYGPGPKMMGLGL
MAKDKDKTVHKKVTCPPTVTVKDEQSGGGNVSSTLLKQHLSLEPCTKTTM
QLRKNHSSAQFIDSYICQVCSRGDEDDKLLFCDGCDDNYHIFCLLPPLPE
IPRGIWRCPKCILAECKQPPEAFGFEQATQEYSLQSFGEMADSFKSDYFN
MPVHMVPTELVEKEFWRLVSSIEEDVTVEYGADIHSKEFGSGFPVSNSKQ
NLSPEEKEYATSGWNLNVMPVLDQSVLCHINADISGMKVPWLYVGMVFSA
FCWHIEDHWSYSINYLHWGEPKTWYGVPSLAAEHLEEVMKMLTPELFDSQ
PDLLHQLVTLMNPNTLMSHGVPVVRTNQCAGEFVITFPRAYHSGFNQGYN
FAEAVNFCTADWLPAGRQCIEHYRRLRRYCVFSHEELICKMAAFPETLDL
NLAVAVHKEMFIMVQEERRLRKALLEKGVTEAEREAFELLPDDERQCIKC
KTTCFLSALACYDCPDGLVCLSHINDLCKCSSSRQYLRYRYTLDELPTML
HKLKIRAESFDTWANKVRVALEVEDGRKRSFEELRALESEARERRFPNSE
LLQRLKNCLSEVEACIAQVLGLVSGQVARMDTPQLTLTELRVLLEQMGSL
PCAMHQIGDVKDVLEQVEAYQAEAREALATLPSSPGLLRSLLERGQQLGV
EVPEAHQLQQQVEQAQWLDEVKQALAPSAHRGSLVIMQGLLVMGAKIASS
PSVDKARAELQELLTIAERWEEKAHFCLEARQKHPPATLEAIIRETENIP
VHLPNIQALKEALTKAQAWIADVDEIQNGDHYPCLDDLEGLVAVGRDLPV
GLEELRQLELQVLTAHSWREKASKTFLKKNSCYTLLEVLCPCADAGSDST
KRSRWMEKALGLYQCDTELLGLSAQDLRDPGSVIVAFKEGEQKEKEGILQ
LRRTNSAKPSPLAPSLMASSPTSICVCGQVPAGVGVLQCDLCQDWFHGQC
VSVPHLLTSPKPSLTSSPLLAWWEWDTKFLCPLCMRSRRPRLETILALLV
ALQRLPVRLPEGEALQCLTERAIGWQDRARKALASEDVTALLRQLAELRQ
QLQAKPRPEEASVYTSATACDPIREGSGNNISKVQGLLENGDSVTSPENM
APGKGSDLELLSSLLPQLTGPVLELPEAIRAPLEELMMEGDLLEVTLDEN
HSIWQLLQAGQPPDLDRIRTLLELEKFEHQGSRTRSRALERRRRRQKVDQ
GRNVENLVQQELQSKRARSSGIMSQVGREEEHYQEKADRENMFLTPSTDH
SPFLKGNQNSLQHKDSGSSAACPSLMPLLQLSYSDEQQL

Кодований геном білок за функціями належить до оксидоредуктаз, регуляторів хроматину. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном цинку, іоном заліза. Локалізований у ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Agulnik A.I., Bishop C.E., Lerner J.L., Agulnik S.I., Solovyev V.V. (1997). Analysis of mutation rates in the SMCY/SMCX genes shows that mammalian evolution is male driven.. Mamm. Genome 8: 134 — 138.  PubMed DOI:10.1007/s003359900372
  • Lee M.G., Norman J., Shilatifard A., Shiekhattar R. (2007). Physical and functional association of a trimethyl H3K4 demethylase and Ring6a/MBLR, a polycomb-like protein.. Cell 128: 877 — 887.  PubMed DOI:10.1016/j.cell.2007.02.004
  • Akimoto C., Kitagawa H., Matsumoto T., Kato S. (2008). Spermatogenesis-specific association of SMCY and MSH5.. Genes Cells 13: 623 — 633.  PubMed DOI:10.1111/j.1365-2443.2008.01193.x

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:11115 (англ.). Процитовано 13 вересня 2017. 
  4. UniProt, Q9BY66 (англ.). Процитовано 13 вересня 2017. 

Див. також[ред. | ред. код]