KMT2A

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
KMT2A
Protein MLL PDB 2j2s.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи KMT2A, ALL-1, CXXC7, HRX, HTRX1, MLL, MLL/GAS7, MLL1, MLL1A, TET1-MLL, TRX1, WDSTS, MLL-AF9, lysine methyltransferase 2A, Histone-lysine N-methyltransferase HRX
Зовнішні ІД MGI: 96995 HomoloGene: 4338 GeneCards: KMT2A
Пов'язані генетичні захворювання
Wiedemann-Steiner syndrome[1]
Шаблон експресії
PBB GE MLL 212076 at fs.png

PBB GE MLL 212078 s at fs.png

PBB GE MLL 212080 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001197104
NM_005933
NM_024891
NM_001081049
NM_001357549
RefSeq (білок)
NP_001184033
NP_005924
NP_001344478
Локус (UCSC) Хр. 11: 118.44 – 118.53 Mb Хр. 9: 44.8 – 44.88 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

KMT2A (англ. Lysine methyltransferase 2A) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 11-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 3 969 амінокислот, а молекулярна маса — 431 764[5].

Послідовність амінокислот
1020304050
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGG
PGAPPSPPAVAAAAAAAGSSGAGVPGGAAAASAASSSSASSSSSSSSSAS
SGPALLRVGPGFDAALQVSAAIGTNLRRFRAVFGESGGGGGSGEDEQFLG
FGSDEEVRVRSPTRSPSVKTSPRKPRGRPRSGSDRNSAILSDPSVFSPLN
KSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKE
DSLKKIKRTPSATFQQATKIKKLRAGKLSPLKSKFKTGKLQIGRKGVQIV
RRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQ
SPRRIKPVRIIPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVK
TQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDYDPPIKIARLESTPNSR
FSAPSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEEIQVLP
EERSDTPEVHPPLPISQSPENESNDRRSRRYSVSERSFGSRTTKKLSTLQ
SAPQQQTSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPAS
TAPMQGKRKSILREPTFRWTSLKHSRSEPQYFSSAKYAKEGLIRKPIFDN
FRPPPLTPEDVGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAP
RFTPSEAHSRIFESVTLPSNRTSAGTSSSGVSNRKRKRKVFSPIRSEPRS
PSHSMRTRSGRLSSSELSPLTPPSSVSSSLSISVSPLATSALNPTFTFPS
HSLTQSGESAEKNQRPRKQTSAPAEPFSSSSPTPLFPWFTPGSQTERGRN
KDKAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQ
SSSALYPVGRVSKEKVVGEDVATSSSAKKATGRKKSSSHDSGTDITSVTL
GDTTAVKTKILIKKGRGNLEKTNLDLGPTAPSLEKEKTLCLSTPSSSTVK
HSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTDQPK
AQGQESDSSETSVRGPRIKHVCRRAAVALGRKRAVFPDDMPTLSALPWEE
REKILSSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGR
RSRRCGQCPGCQVPEDCGVCTNCLDKPKFGGRNIKKQCCKMRKCQNLQWM
PSKAYLQKQAKAVKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSARE
DPAPKKSSSEPPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQ
PALVIPPQPPTTGPPRKEVPKTTPSEPKKKQPPPPESGPEQSKQKKVAPR
PSIPVKQKPKEKEKPPPVNKQENAGTLNILSTLSNGNSSKQKIPADGVHR
IRVDFKEDCEAENVWEMGGLGILTSVPITPRVVCFLCASSGHVEFVYCQV
CCEPFHKFCLEENERPLEDQLENWCCRRCKFCHVCGRQHQATKQLLECNK
CRNSYHPECLGPNYPTKPTKKKKVWICTKCVRCKSCGSTTPGKGWDAQWS
HDFSLCHDCAKLFAKGNFCPLCDKCYDDDDYESKMMQCGKCDRWVHSKCE
NLSDEMYEILSNLPESVAYTCVNCTERHPAEWRLALEKELQISLKQVLTA
LLNSRTTSHLLRYRQAAKPPDLNPETEESIPSRSSPEGPDPPVLTEVSKQ
DDQQPLDLEGVKRKMDQGNYTSVLEFSDDIVKIIQAAINSDGGQPEIKKA
NSMVKSFFIRQMERVFPWFSVKKSRFWEPNKVSSNSGMLPNAVLPPSLDH
NYAQWQEREENSHTEQPPLMKKIIPAPKPKGPGEPDSPTPLHPPTPPILS
TDRSREDSPELNPPPGIEDNRQCALCLTYGDDSANDAGRLLYIGQNEWTH
VNCALWSAEVFEDDDGSLKNVHMAVIRGKQLRCEFCQKPGATVGCCLTSC
TSNYHFMCSRAKNCVFLDDKKVYCQRHRDLIKGEVVPENGFEVFRRVFVD
FEGISLRRKFLNGLEPENIHMMIGSMTIDCLGILNDLSDCEDKLFPIGYQ
CSRVYWSTTDARKRCVYTCKIVECRPPVVEPDINSTVEHDENRTIAHSPT
SFTESSSKESQNTAEIISPPSPDRPPHSQTSGSCYYHVISKVPRIRTPSY
SPTQRSPGCRPLPSAGSPTPTTHEIVTVGDPLLSSGLRSIGSRRHSTSSL
SPQRSKLRIMSPMRTGNTYSRNNVSSVSTTGTATDLESSAKVVDHVLGPL
NSSTSLGQNTSTSSNLQRTVVTVGNKNSHLDGSSSSEMKQSSASDLVSKS
SSLKGEKTKVLSSKSSEGSAHNVAYPGIPKLAPQVHNTTSRELNVSKIGS
FAEPSSVSFSSKEALSFPHLHLRGQRNDRDQHTDSTQSANSSPDEDTEVK
TLKLSGMSNRSSIINEHMGSSSRDRRQKGKKSCKETFKEKHSSKSFLEPG
QVTTGEEGNLKPEFMDEVLTPEYMGQRPCNNVSSDKIGDKGLSMPGVPKA
PPMQVEGSAKELQAPRKRTVKVTLTPLKMENESQSKNALKESSPASPLQI
ESTSPTEPISASENPGDGPVAQPSPNNTSCQDSQSNNYQNLPVQDRNLML
PDGPKPQEDGSFKRRYPRRSARARSNMFFGLTPLYGVRSYGEEDIPFYSS
STGKKRGKRSAEGQVDGADDLSTSDEDDLYYYNFTRTVISSGGEERLASH
NLFREEEQCDLPKISQLDGVDDGTESDTSVTATTRKSSQIPKRNGKENGT
ENLKIDRPEDAGEKEHVTKSSVGHKNEPKMDNCHSVSRVKTQGQDSLEAQ
LSSLESSRRVHTSTPSDKNLLDTYNTELLKSDSDNNNSDDCGNILPSDIM
DFVLKNTPSMQALGESPESSSSELLNLGEGLGLDSNREKDMGLFEVFSQQ
LPTTEPVDSSVSSSISAEEQFELPLELPSDLSVLTTRSPTVPSQNPSRLA
VISDSGEKRVTITEKSVASSESDPALLSPGVDPTPEGHMTPDHFIQGHMD
ADHISSPPCGSVEQGHGNNQDLTRNSSTPGLQVPVSPTVPIQNQKYVPNS
TDSPGPSQISNAAVQTTPPHLKPATEKLIVVNQNMQPLYVLQTLPNGVTQ
KIQLTSSVSSTPSVMETNTSVLGPMGGGLTLTTGLNPSLPTSQSLFPSAS
KGLLPMSHHQHLHSFPAATQSSFPPNISNPPSGLLIGVQPPPDPQLLVSE
SSQRTDLSTTVATPSSGLKKRPISRLQTRKNKKLAPSSTPSNIAPSDVVS
NMTLINFTPSQLPNHPSLLDLGSLNTSSHRTVPNIIKRSKSSIMYFEPAP
LLPQSVGGTAATAAGTSTISQDTSHLTSGSVSGLASSSSVLNVVSMQTTT
TPTSSASVPGHVTLTNPRLLGTPDIGSISNLLIKASQQSLGIQDQPVALP
PSSGMFPQLGTSQTPSTAAITAASSICVLPSTQTTGITAASPSGEADEHY
QLQHVNQLLASKTGIHSSQRDLDSASGPQVSNFTQTVDAPNSMGLEQNKA
LSSAVQASPTSPGGSPSSPSSGQRSASPSVPGPTKPKPKTKRFQLPLDKG
NGKKHKVSHLRTSSSEAHIPDQETTSLTSGTGTPGAEAEQQDTASVEQSS
QKECGQPAGQVAVLPEVQVTQNPANEQESAEPKTVEEEESNFSSPLMLWL
QQEQKRKESITEKKPKKGLVFEISSDDGFQICAESIEDAWKSLTDKVQEA
RSNARLKQLSFAGVNGLRMLGILHDAVVFLIEQLSGAKHCRNYKFRFHKP
EEANEPPLNPHGSARAEVHLRKSAFDMFNFLASKHRQPPEYNPNDEEEEE
VQLKSARRATSMDLPMPMRFRHLKKTSKEAVGVYRSPIHGRGLFCKRNID
AGEMVIEYAGNVIRSIQTDKREKYYDSKGIGCYMFRIDDSEVVDATMHGN
AARFINHSCEPNCYSRVINIDGQKHIVIFAMRKIYRGEELTYDYKFPIED
ASNKLPCNCGAKKCRKFLN

Кодований геном білок за функціями належить до трансфераз, регуляторів хроматину, метилтрансфераз, фосфопротеїнів. Задіяний у таких біологічних процесах, як апоптоз, транскрипція, регуляція транскрипції, біологічні ритми, ацетилювання, альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном цинку, ДНК, S-аденозил-L-метіоніном. Локалізований у ядрі.

Література[ред. | ред. код]

  • Tkachuk D.C., Kohler S., Cleary M.L. (1992). Involvement of a homolog of Drosophila trithorax by 11q23 chromosomal translocations in acute leukemias.. Cell 71: 691 — 700.  PubMed DOI:10.1016/0092-8674(92)90602-9
  • Hsieh J.J.-D., Ernst P., Erdjument-Bromage H., Tempst P., Korsmeyer S.J. (2003). Proteolytic cleavage of MLL generates a complex of N- and C-terminal fragments that confers protein stability and subnuclear localization.. Mol. Cell. Biol. 23: 186 — 194.  PubMed DOI:10.1128/MCB.23.1.186-194.2003
  • Hsieh J.J.-D., Cheng E.H.-Y., Korsmeyer S.J. (2003). Taspase1: a threonine aspartase required for cleavage of MLL and proper HOX gene expression.. Cell 115: 293 — 303.  PubMed DOI:10.1016/S0092-8674(03)00816-X
  • Patel A., Dharmarajan V., Vought V.E., Cosgrove M.S. (2009). On the mechanism of multiple lysine methylation by the human mixed lineage leukemia protein-1 (MLL1) core complex.. J. Biol. Chem. 284: 24242 — 24256.  PubMed DOI:10.1074/jbc.M109.014498
  • De Guzman R.N., Goto N.K., Dyson H.J., Wright P.E. (2006). Structural basis for cooperative transcription factor binding to the CBP coactivator.. J. Mol. Biol. 355: 1005 — 1013.  PubMed DOI:10.1016/j.jmb.2005.09.059
  • Patel A., Dharmarajan V., Cosgrove M.S. (2008). Structure of WDR5 bound to mixed lineage leukemia protein-1 peptide.. J. Biol. Chem. 283: 32158 — 32161.  PubMed DOI:10.1074/jbc.C800164200

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]